×

Find gifts by describing the person you are trying to buy for. Use things like who they are (dad), their hobbies (star wars), their personality (geek, gamer).

You searched for: weapongamingbedroomcampingtravelpetsminecraftparks and recreationglassgamerpartyartsyfirefly

Reset Tags. (Click a tag to remove it. Add tags on the left side.)

Gerber 31-000751 Bear Grylls Survival Series Ultimate Knife, Serrated Edge

Intricately designed by Gerber and Bear, it's loaded with innovations that won't be found in any other fixed blade knife. Like everything in the Survival Series, it also includes Bear's Priorities of Survival pocket guide.

$42.13Details


Captain Mal's Pistol from Firefly - Resin cast kit - Hand Painted

Offered here is a premade cast resin kit of Jayne's Custom Lemat "Boo" from Firefly and Serenity fame.

$249.99Details


Weber 386002 Q 100 Portable Propane Gas Grill

The grill ignites at the push of a button for reliable lighting, and an infinitely adjustable burner valve with a high-quality regulator makes it easy to control the heat.

$134.24Details

SHOT GLASS ICE MOLD (13PC. SET)

Take the chill off your next soiree when you serve guests a shot in an edible frozen glass.

$14.99Details


Men's Tetris Tie by Game Tie in Black

The classics of menswear and video games have finally come together to bring you this remarkable men's Tetris necktie.

$35.00Details

Das Boot

Das Boot.

$34.99Details


Camelbak M.U.L.E. 100 oz Hydration Pack, Chili Pepper/Charcoal

The M.U.L.E. NV from Camelbak is a narrow-gauge pack for 3+ hours of all-terrain adventures in any weather.

$69.98Details

8 Bit Tie

A reminder of better days.

$14.99Details


Flip UltraHD Video Camera

Taking HD video has never been so easy or portable! Flip HD lets you capture every moment with dazzling quality without breaking the bank.

$129.00Details

World Of Warcraft Deluxe Latex Mask, Troll, Green, One Size

Sometimes I wish I could roam around the mall like it were Azeroth. Now I can with my World of Warcraft Troll Mask!

$36.99Details


Kikkerland Skull Shot Glasses, Set of 4

Skull Shot Glasses, do I really need to write more than that?

$11.99Details


The Hungover Cookbook

Learn to cure your hangover with these delicious recipes!

$10.00Details

Nintendo Wall Graphics - Super Mario Bros

Level up your room with this Mario Themed wall graphics.

$74.95Details


12 Gauge Shot Glass

Fire off a few rounds with our set of 12 Gauge Shot Glasses.

$17.95Details

Super Mario Time to Team Up 50-by-60-Inch Microraschel Throw Blanket

Mario and Luigi race to save the game surrounded by icons and characters from your favorite video game. Cuddle up in this warm throw for a long day of video game fun.

$29.99Details


Tailgate Folding Wooden Picnic Table

Have a picnic anywhere with the comfort of your own personal picnic table.

$134.99Details


Fred and Friends Hopside Down Glass

Hopside Down, is that pun not enough of a description?

$20.00Details

Mario Bros.: Koopa Shell Plush and Backpack

You never know when you need a turtle shell.

$39.95Details


Sea to Summit Pocket Shower

Bring an 8 minute shower anywhere you go. Also works as a regular dry sack.

$24.21Details

Sport-Brella Umbrella Chair, Blue

Tired of all the shady spots being taken? Bring your own chair and shade together!

$39.99Details


Sea To Summit Ultra-Sil Daypack

Backpack that fits on a keychain.

$26.96Details

Ten One Design Fling Game Controller - Ninja

Fling is a tactile game controller for iPad.

$9.50Details


Halo 3, Master Chief Costume, Adult Standard

Quilted jumpsuit with EVA armor, two-piece deluxe helmet, gauntlets and boot tops.

$580.46Details

Aperture Science Mug

Welcome to Aperture Laboratories, A Trusted Friend in Science!

$12.99Details


Helter Skelter Drinks Chiller

Warm drinks are so 20th century.

$33.18Details

Fred Cool Jazz Ice Cube Tray

It is time to kick back and chill and here is a cool way to do it! Drop one of these groovy guitars into your drink, and give it a stir. Just the thing for jazzing up your favorite beverage.

$7.99Details


True Fabrications Chain Bottle Rack

Use the magic chain to proudly show your wine anywhere. Simply put a bottle through the loop and let the chrome plated steel chain do the rest.

$24.95Details

Lush Life Party Ice Luge

Let the fun begin when your pour your favorite drink down the luge.

$22.50Details


Wii Classic Controller Pro - Black

Created for accessibility and comfort, the Classic Controller Pro blends design elements from game systems such as the NES, Super NES, and Nintendo 64 providing seamless play control for a wide range of games.

$19.99Details

Razer Spectre StarCraft II Gaming Mouse

Razer Spectre StarCraft II gaming mouse is a lightweight, five button mouse that is ideal for gamers that prefer precision and control for an RTS.

$63.11Details


Starcraft II 2 Dog Tag USB 2gb drive James Jim Raynor

Starcraft 2 Dogtag USB Stick ensures you're the coolest kid at the lan party.

$90.00Details

The StarCraft Bible 2nd Edition: Who knew that explosions of pixels could inspire?

This is the history of StarCraft. This is the love of e-sports. This is the Bible of StarCraft.

$16.99Details


StarCraft II: Heart of the Swarm (Pre-Order)

Heart of the Swarm expansion for Starcraft 2

$59.99Details

Razer Marauder StarCraft II Gaming Keyboard

The Razer Marauder StarCraft II gaming keyboard is a full featured, tournament ready keyboard with an extremely compact design.

$98.35Details


Razer Banshee StarCraft II Gaming Headset

With its circumaural design the Razer Banshee is designed for optimal sound isolation to allow you to focus completely on your game.

$100.23Details


Firefly Necklace- You can't take the sky from me

Can't take the sky from me necklace

$25.00Details

Serenity Firefly Crime To Be Done Mal T-shirt

Got us some crime to be done.

$17.95Details


Firefly Logo T-Shirt

We like Firefly. You like Firefly. This here's a Firefly all official-like t-shirt.

$17.99Details


(12x16) Serenity Movie Firefly Blueprints Reference Pack Spiral Bound Book

Blueprints in case you ever want to make your own Serenity

$42.93Details


River Tam and the Fireflies (Poster)

Join the crew of this firefly class transport ship as they aim to misbehave with hit songs such as "I Swallowed A Bug", "Nothin' Twixt My Nethers", and their new, hit single "Miranda".

$20.00Details


Firefly Poster TV 11x17 Nathan Fillion Morena Baccarin Adam Baldwin Ron Glass

Firefly Reproduction Poster Print Style A 11 x 17 Inches -28cm x 44cm

$19.99Details

Firefly Fruity Oaty Bar Not Mandatory T-shirt XL

This cool Serenity t-shirt features the Fruity Oaty Bar ad in a high quality, vintage look print.

$22.95Details



DiY Serenity Firefly Small Tote Bag Malcolm Reynolds

This is a brand new lightweight small purple tote bag.

$12.00Details

(24x36) Serenity Movie (Firefly Group) Poster Print

(24x36) Serenity Movie (Firefly Group) Poster Print

$9.80Details


Firefly Light Tile Pendant FF4

Firefly Light Scrabble Tile Pendant (Pendant Only)

$8.00Details

Firefly Poster TV D 11x17 Nathan Fillion Morena Baccarin Adam Baldwin Ron Glass

Firefly reproduction Approx. Size: 11 x 17 Inches - 28cm x 44cm Style D mini poster print

$24.99Details


Firefly: Still Flying: A Celebration of Joss Whedon's Acclaimed TV Series

Still Flying is a brand new celebration of all aspects of the show, featuring a wealth of rare and previously unpublished images including storyboards, production design art and candid behind the scenes photos, memories from the cast

$13.57Details

Firefly Serenity 36 Inch Full Afterburner Fiberglass Model Built, Finished, Painted, and Lighted

Full Afterburner 36 inch fiberglass Firefly model ready for display.

$599.00Details


Joss Whedon's Serenity Ornament Inara's Shuttle

Fans of Firefly will be familiar with the shuttle that Inara Serra, well-respected companion, rents from Serenity for her periods of separation from the ragtag crew.

$19.95Details


Serenity - Firefly Metal Keychain

Serenity is about freedom. Serenity is about going where you want, when you want, with nothing in The Verse to stop you.

$22.98Details

Joss Whedon's Firefly Serenity 11x17 Original Promotional Movie Poster

Promotional Serenity Movie poster. These were given to theaters and also sci fi convention promotors to hand out to fans. Along with everything Serenity, they have become highly collectible.

$9.95Details


Firefly Inspired - Leaf on the Wind, Watch How I Soar Necklace

'I am a leaf on the wind. Watch how I soar.' Only a Firefly fan would appreciate the tragic beauty of Wash's last line.

$17.95Details

Serenity Atlas of the Verse, Volume 1

The Atlas of The Verse is loaded with beautiful art, incredible renderings and detailed diagrams that really help bring The Verse to life.

$42.42Details


Serenity PVC Set

You get Mal, River, and Jayne in this set of PVC figures based on Joss Whedon's blockbuster film Serenity.

$19.99Details

Firefly Serenity in Flight Bumper Sticker

A Boat in the Air We Can All Love

$7.63Details



Serenity (Widescreen Edition)

The Firefly Movie. Picks up where Firefly left off, but doesn't alienate people who have never seen the TV show.

$9.99Details

Bronze Firefly Wash quote bracelet

Firefly Fans and Family. I have made a bronze and leather appx 1 inch cuff with the I am a leaf on the wind leather name plate.

$35.00Details


Done The Impossible: The Fans' Tale of Firefly & Serenity

Adam Baldwin hosts the telling of this vivid Browncoat story that features interviews with Joss Whedon, creator of Firefly and Serenity, the cast, crew, and most important, the fans themselves.

$12.95Details

Quantum Mechanix Serenity: Big Damn Heroes: River Tam Maquette

Serenity's psychotic killing machine River Tam

$49.98Details


Firefly/Serenity Jayne Hat

This awesomely cunning hat, in the style of our favorite PR specialist from Firefly - Jayne Cobb, is made of SUPER soft acrylic in colors that perfectly match the original from the show!

$35.00Details

Firefly Inspired Tshirt - Also, I Can Kill You with My Brain

A fantastic printed t-shirt inspired by the Firefly and Serenity. (Price GBP)

$9.99Details


Serenity Define Interesting T-Shirt

Define Interesting. 1. Capable of holding one's attention. 2. Arousing a feeling of interest. 3. Oh God, oh God, we're all going to die.

$21.88Details

Firefly (Original Television Soundtrack)

Composer Greg Edmonson created a flavorful, guitar-based score for the adventures of the crew of Serenity. CD features exclusive bonus tracks.

$14.99Details


Serenity

This action/adventure/Sci-Fi/western features an eclectic score by composer David Newman.

$17.04Details


Don't Make Me Think: A Common Sense Approach to Web Usability, 2nd Edition

100,000 copies sold. If you do anything web related, this book is a must read.

$40.00Details


Altec Lansing inMotion MIX iMT800 Portable Digital Boom Box for iPhone and iPod

Altec Lansing iMT800 "MIX" Get ready to Rock the house! Versatile iPhone/ iPod docking with three separate inputs and FM radio, LCD display

$299.95Details

Glow Graffiti Toolset - Paint with Light

It's the dead of night; everyone is tucked up in bed and the owls are-a-hooting. So it's time to break out the Glow Graffiti!

$34.99Details


The Design of Everyday Things

Anyone who designs anything to be used by humans--from physical objects to computer programs to conceptual tools--must read this book, and it is an equally tremendous read for anyone who has to use anything created by another human.

$15.95Details

Soft Heat Micro-Plush Top Low-Voltage Electric Heated Twin Mattress Pad, White

"Amazing" is the best word to describe this ultra-plush pad with its incredibly soft, supportive and luxurious Micro-Velour fabric top.

$65.99Details


Diablo III

Shut up and take my money Blizzard.

$59.99Details

Philips Hf3470/60 Wake-up Light, White

This alarm turns a light on slowly to help you wake up. Clinically proven to make waking up more pleasant.

$99.99Details


Electronic Guitar Shirt

You air guitar getting old? Step up your game with this rockstar guitar tshirt with built in mini amp.

$19.99Details

Cards Against Humanity

Cards Against Humanity is a party game for horrible people. Unlike most of the party games you've played before, Cards Against Humanity is as despicable and awkward as you and your friends.

$25.00Details


Star Wars: The Old Republic

Star Wars: The Old Republic is a Massively Multiplayer Online Role-playing Game

$59.95Details

Bear Grylls Survival Series Ultimate Kit

The product of collaboration between Gerber and survival expert Bear Grylls, the Ultimate Kit is a 15-piece survival kit built for hostile environments.

$67.50Details


Britax Frontier 85 Combination Booster Car Seat, Rushmore

The new Britax frontier 85 combination harness 2 booster boasts best in class forward-facing five-point harnessed weight capacity up to 85 pounds with an industry-leading 20" shoulder harness height.

$212.49Details

Kinect Star Wars

Feel the Force as you transform yourself into a Jedi. Fully harnesses the power of the Kinect platform to deliver a natural and intuitive Star Wars experience.

$49.96Details


Lumisource NESSIE Table Desk Lamp

Inspired by Nessie the Lochness Monster, this light keeps your kids company and is fun to play with.

$45.00Details

Swedish Firesteel - Army Model, Black Handle

Originally developed for the Swedish Department of Defense, Swedish FireSteel is a flash of genius. Its 3,000°C spark makes fire building easy in any weather, at any altitude.

$15.05Details


Treat Yo Self triangle necklace

Velvet slippies, cashmere socks, velvet pants, cashmere turtle. I'm a cashmere velvet candy cane

$30.00Details

Umbra FishHotel Aquarium

Is your fish getting to old to live at home? This condo is the perfect balance of freedom and comfort for your beloved fish.

$38.50Details


Black Light Reactive Neon Makeup with Black Light Pendant (Yellow)

This awesome UV make up kit allows you to add neon flare to your boring every day make up.

$6.99Details


Ninja Coat Hook

Hang up your coat Yakuza style! This Ninja Coat Hook will transform your entry way into a dangerous Tokyo alley.

$9.11Details

Eagles Nest Outfitters DoubleNest Hammock (Orange/Grey)

The DoubleNest seats more than one person comfortably and is essential for family adventures. The DoubleNest still packs down to the size of a grapefruit, so there is no excuse to be without your ENO hammock.

$64.95Details



Flash Cooking System Sapphire Blue 000 by JETBOIL

Designed to capture and focus heat more efficiently than traditional cooking systems, the Flash brings two cups of water to a boil in only two minutes.

$80.71Details


Parks and Recreation Li'l Sebastian T-Shirt, Large

I Met Li'l Sebastian at the Pawnee harvest festival.

$26.00Details

Mr. Beer Premium Gold Edition Home Brew Kit

A great starting point for a beginning and intermediate brewers, it includes two of Mr. Beer's most popular beer mixes as well as everything needed to both brew and bottle your first 2 batches of top-quality beer.

$59.99Details


THE EX Kitchen Knife Set by Raffaele Iannello, Black

Not only functional, but also therapeutic, this five-piece knife set plus holder makes for the perfect gift and a guaranteed conversation piece.

$169.99Details

Parks and Recreation Mouse Rat T-Shirt, Medium

Mouse Rat or was it Threeskin?

$26.00Details



Small 4" Round EcoSphere

A perfectly balanced ecosystem that fits on your desk.

$101.53Details

Parks and Recreation Trippin' Tammy T-Shirt, Medium

Quite possibly the most awesome shirt in existence.

$26.00Details


Cute Fire Extinguisher Lighter With LED Light

Irony is always in style, right? Light up with this extinguisher.

$9.00Details

Parks And Recreation Poster 24x36in

Poster of the awesome cast of Parks and Rec

$19.97Details


Parks and Recreation Mouse Rat Zippo Lighter

Required gear for any Mouse Rat concert.

$29.95Details

Boyfriend Pillow

Want to cuddle but nobody is around? The boyfriend pillow will hold you, every night, all night.

$60.00Details


Parks and Recreation Fourth in Obesity T-Shirt, Large

First in Friendship, Fourth in Obesity.

$26.00Details

SWANSON PYRAMID T-Shirt

Ron Swanson Pyramid of Greatness t-shirt!

$16.99Details


Entertainment 720 Shirt, With Jean-Ralphio T-Shirt

Sip on some snakejuice and show your love for television's Parks and Recreation and Entertainment 720 while wearing this screen printed grey 90% cotton shirt.

$14.00Details


Audio-Technica ATH-M50 Professional Studio Monitor Headphones

One of the most popular headphone sets in existence. Designed for DJs/Producers, they are fantastic for anyone.

$159.00Details

Ron Swanson Bacon & Eggs Shirt in Cream

With eggs for eyes and a bacon 'stache, Ron Swanson is illustrated with two of his favorite foods in my original design.

$22.00Details


Fasta Pasta The Microwave Cooker

No waiting for a big pot of water to boil. Cook pasta to al dente perfection in the microwave! Saves time, energy and water.

$8.99Details

Exhaust Powered Car Jack

Jack your car up with the exhaust it's generating, simple and elegant car repair.

$224.98Details


Meat Tornado Poster

Quote from one of the manliest characters in history, Mr. Ron Swanson himself.

$16.50Details

iHome iHM60LT Rechargeable Mini Speaker (Blue Translucent)

The iHM60 is an amazing approach to audio that offers size defying sound. Speaker connects to a computer or other USB power source via the included USB cable to recharge the internal lithium ion battery.

$19.99Details


Peekaru Original Fleece Baby Carrier Cover Medium - Black

Share the warmth with your baby or toddler. The Peekaru Original is an environmentally friendly fleece vest that fits over you and your baby, keeping you both warm without giving up the comfort of your favorite baby carrier.

$79.95Details

Ron Swanson Fishing Poster

Fish ain't no bacon.

$16.50Details


Satechi CR -3600 car holder mount for iPhone 4S, 4, 3G & 3GS, BlackBerry Torch, HTC EVO, DROID, Samsung EPIC on Windshield and Dashboard

Using a smartphone as a GPS? Mount it in your car properly just like a traditional GPS.

$29.99Details

Boon Glo Nightlight with Portable Balls, White

Boon Glo nightlight. Portable, don't heat up, turn off after 30 minutes and 95% effective at keeping monsters away all night long.

$84.99Details


Clear Blue Hawaii Molokini 2 - Person Kayak

Transparent Molokini Kayak. Discover. Explore. See. Witness fascinating lake or sea life through the sleek transparent hull. This is a great investment whether your goal is serious research or a child's voyage of discovery.

$2,243.17Details

Woman Of The Year Juniors T-Shirt

Woman of the Year - Ron Swanson

$23.95Details


Bananagrams

The Anagram game that will drive you bananas. The award-winning word game that needs no pencil, paper, or board. Fast and fun.

$14.95Details

About Face 3: The Essentials of Interaction Design

This completely updated volume presents the effective and practical tools you need to design great desktop applications, Web 2.0 sites, and mobile devices. This book will teach you the principles of good product behavior.

$45.00Details


Victorinox Swiss Army Classic Pocket Knife

The Classic is the perfect pocket-size model, with seven functions, including tweezers and toothpick.

$17.50Details

Vinturi Essential White Wine Aerator

Specially designed to aerate white wine and produce better bouquet, enhanced flavors and smoother finish

$42.89Details


iMPROV Electronics 8.5" Boogie Board Tablet

You can utilize this writing tablet for home, office or school activity and you will never need a paper or pencil again.

$34.95Details



Chillow ® Comfort Device

The Chillow® is a noiseless, low-cost cooling alternative that is environmentally friendly

$23.95Details

Something to Read on the Plane

A delightfully light-hearted variety of stories, articles, limericks, and even a quiz to see how good a passenger you are.

$0.99Details


Lightphoria 10,000 lux SAD Light Therapy Pad (Seasonal Affective Disorder) Sunlight Simulator. 2011 model (v2.1)

Bright light has been used for over a decade to alleviate symptoms associated with Seasonal Affective Disorder (SAD), jetlag, shift work fatigue, insomnia, seasonal change and more.

$99.99Details

Fascinations AntWorks Illuminated Blue

Study the life-cycle of ants in this space-age gel habitat 3-dimensional ant city in the making.

$28.49Details


Joby GP1-E1EN Gorillapod Flexible Tripod (Grey)

Gorillapod lets you mount your camera just about anywhere you want so that you can include everyone in your automatic shots.

$14.26Details

Steve Jobs

Autobiography of Steve Jobs

$17.87Details


Chessex Dice: Pound of Dice (Pound-O-Dice) Approximately 100 Die

For only the most extreme board game player or gambler.

$18.85Details

Bed Fan

The Bed Fan delivers a cool breeze between the sheets--without AC costs, and without disturbing your partner.

$79.95Details


3M Self Adhesive Dry Erase Material. 24"" x 10-Feet Long.

Turn any wall into a dry erase board.

$12.50Details

Can You Imagine 2320 Melting Clock

A Dali-eque functioning clock.

$14.99Details


Desktop Warfare Kits (Catapult)

Your own personal catapult.

$25.99Details


Metal Jewelry Stand Tree with an Antique Silver & Gold Finish

Iron Jewelry Tree Stand Unique tree design with leaves and branches Done in an antique silver/gold finish Works great for necklaces and bracelets and has 40 hanging positions

$23.99Details

Pet Umbrella (Dog Umbrella) Keeps your Pet Dry and Comfotable in Rain

Keep your pet happy and dry in rain, sleet or snow!

$14.95Details


1888 Mills Luxury Cotton Made in Africa Bath Towel, White

Super soft bath towel from African cotton with sales contributing to reducing poverty in Africa.

$16.03Details

Better Sleep Pillow - A Multi Position Pillow for Side Sleepers, Stomach Slee...

Now you can enjoy the benefits of the most comfortable multi-functional doctor-approved pillow.

$99.99Details


Drinkwell Platinum Pet Fountain

Pet water fountain.

$44.06Details

Roulette Shot Glass Bar Drinking Game Set

The party starts when the ball stops rolling!

$29.99Details


Midnight in Paris

This is a romantic comedy set in Paris about a family that goes there because of business, and two young people who are engaged to be married in the fall have experiences there that change their lives. It's about a young man's great love for a

$17.99Details


10 Sky Lanterns - White

Celebrate a special occasion with these amazing sky lanterns.

$28.99Details

Annie Hall

Annie Hall is one of the truest, most bittersweet romances on film.

$10.49Details


Cat Attack Scratching Post

Run for your lives! Catzilla is tearing up the city once again thanks to the Cat Attack Scratching Post!

$29.99Details

Manhattan

Manhattan is a wry, touching and finely rendered portrait of modern relationships against the backdrop of urban alienation.

$14.49Details


Hops Holster 12 Can Ammo Pack

When you're ready to wage war on thirst (and possibly sobriety) the Hops Holster 12 Can Ammo Pack is the only beer holder gear you need.

$39.95Details

Nerf N-Force Marauder Long Sword - Black

A sword designed for full contact fighting.

$38.77Details


Pantone Universe Mug Violet 7672

The PANTONE UNIVERSE mugs by Whitbread Wilkinson are made with fine bone china.

$15.95Details

Stimulo Cat Feeding Station and Activity Center

Make your cats work for their food.

$24.92Details


Got Wood?

T-Shirt (Also available as Hoodie)

$24.54Details

Razer StarCraft II Zerg Edition Messenger Bag

The Starcraft II Zerg Edition Messenger Bag is designed for gamers who want to keep their gear protected, stay comfortable, and look good doing it.

$59.77Details


Creeper Mousepad

You'll receive one cloth topped mousepad that is backed with non-slip, non-marking rubber.

$12.00Details

Minecraft Diamond Ring

The ring is adjustable, and the figure is made from Polymer clay. It is painted with acrylic paint and finished with Min-Wax polycrylic to seal and protect it.

$10.00Details


Minecraft inspired Grass Cube Tissue Box Cover

Save your desk or nightstand from those ugly cardboard tissue boxes!

$18.00Details

Pwned Mug

PWNED.

$9.99Details



Minecraft Diamond Earrings

Advertise your love for Minecraft with these rare gems! Here is a pair of gorgeous diamond earrings, straight from the depths of my private mine. Diamonds *are* a miner's best friend.

$10.00Details

Thermos Stainless King SK1005MB4 16-Ounce Leak-Proof Travel Mug, Midnight Blue

The ultra-durable, leak-proof Thermos Stainless King travel mug features an unbreakable stainless steel interior and exterior, making it a great companion for use in rough-and-tumble situations such as construction sites, delivery work, and more.

$19.43Details


3D Pig from Minecraft

Oink! Oink!

$20.00Details

Pelican 1170 Carrying Case for Multi-Purpose - Black

Hand-held electronics protection solution. Watertight, crushproof, and dust proof. Easy open Double Throw latches. Open cell core with solid wall design - strong, light . O-ring seal. Automatic Pressure Equalization Valve. Pick N Pluck with convoluted li

$34.24Details


Minecraft Diamond Tool/Weapon Magnet Set

Each magnet has at least one strong round magnet or bar magnet so they're not only fun but functional. See my shop for other Minecraft sets, including this one in iron and gold.

$10.00Details


Minecraft University Hoodie

Ad Gloriam et Porcos (For pigs and glory!)

$59.99Details


Longclaw, Sword of Jon Snow. Licensed from George R.R. Martin's "A Game of Thrones"

For five centuries the Valyrian steel sword Longclaw was carried by the Lords of Bear Island in the service of the Starks of Winterfell.

$249.95Details

Minecraft Note Cube

Leaves no cobblestone residue once fully mined

$14.95Details


Needle, Sword of Arya Stark. Licensed from George R.R. Martin's "A Song of Ice and Fire."

Lighter, thinner, and smaller than a typical Westeros blade, the style was closer to that of Braavos across the Narrow Sea, to be used for thusting and slashing, style of combat more suited to the quick and agile, rather than those with raw strength.

$199.95Details

Minecraft Sheet Magnets

80 1" square blocks on each sheet (2 sheets)

$21.53Details


King Robert's Warhammer

Rhaegar fought valiantly, Rhaegar fought nobly, Rhaegar fought honorably. And Rhaegar died.

$270.00Details

Minecraft Drop it Creep Premium Tee S

A Creeper bounces his way up to an unsuspecting clerk, Give me all your money, bookworm, or I blow up your brainssssSSSsss!

$21.99Details


Ice, Sword of Eddard Stark, Damascus Edition

If you would take a man's life, you owe it to him to look into his eyes and hear his final words. And if you can not do that, then perhaps the man does not deserve to die.

$700.00Details

Minecraft Foam Pickaxe

The Minecraft Foam Pickaxe is made from sturdy EVA foam, which means that unlike the stone pickaxe in the game, the Minecraft Foam Pickaxe will withstand far more than 132 uses.

$49.99Details


Firefly - The Complete Series

One of the greatest shows to ever be cancelled.

$24.99Details

Minecraft Creeper Anatomy T-Shirt

The Creeper (Creepus explodus) is an all-terrain combustible terror of destruction, indigenous to dark caves found deep beneath the earths crust, and luxurious neighborhoods with glass houses and nice fancy everythings.

$19.99Details


Minecraft Confused Shirt

We presume that to a denizen of Minecraft spheres would be sort of like what non-Euclidean geometry is to us.

$19.99Details

Silk Nightgown and Robe Set - Royal Peacocks

The robe, on the back, features a pair of majestic peacocks perched on a tree brimming with deep red autumn colors. The painting flows into the front of the robe as well as the gown.

$159.00Details


Minecraft Creeper T-Shirt

Embrace your inner Creeper!

$19.99Details

Pleo Dinosaur - A UGOBE Life Form

Pleo looks, moves, sounds and behaves like a living creature. Fully aware and cognitive, he explores his environment and interacts with people, accessories and other UGOBE dinosaurs.

$508.08Details


Eat Sleep Minecraft T-Shirt

Eat, Sleep Minecraft

$23.52Details

MIU France Zinc Alloy Connoisseur Corkscrew Wine Opener

The next best thing to an in-house sommelier, this professional-quality wine opener offers the same impressive performance and stylish design as corkscrews that cost far more.

$20.99Details


Sir Creeper of Minecraftia

Sir Creeper is a lover of all things expensive, and your newly acquired diamond is looking really good to him right now.

$24.54Details


Don't Fear the Creeper (Sticker)

There's nothing to fear, all he has is an explosive personality!

$2.40Details

Skull & Pickaxes (Sticker)

The traditional Skull & Crossbones with an added Minecraft twist!

$2.40Details


© Gift Lizard 2011