×

Find gifts by describing the person you are trying to buy for. Use things like who they are (dad), their hobbies (star wars), their personality (geek, gamer).

You searched for: watercampingartistmuggamerlightkitchengame of thronesminecraftgirlsdrinkingtravelartsy

Reset Tags. (Click a tag to remove it. Add tags on the left side.)

Pantone Universe Mug Violet 7672

The PANTONE UNIVERSE mugs by Whitbread Wilkinson are made with fine bone china.

$15.95Details

Sea to Summit Pocket Shower

Bring an 8 minute shower anywhere you go. Also works as a regular dry sack.

$24.21Details


Camelbak M.U.L.E. 100 oz Hydration Pack, Chili Pepper/Charcoal

The M.U.L.E. NV from Camelbak is a narrow-gauge pack for 3+ hours of all-terrain adventures in any weather.

$69.98Details

PUR 18 Cup Dispenser with One Pitcher Filter DS-1800Z

Keep your water clear of chemicals and odors with this dispenser from PUR. Its advanced filtration system reduces more contaminants (lead, copper, zinc, etc.) than any other pour-through filter.

$27.81Details


Flip UltraHD Video Camera

Taking HD video has never been so easy or portable! Flip HD lets you capture every moment with dazzling quality without breaking the bank.

$129.00Details


Kikkerland Skull Shot Glasses, Set of 4

Skull Shot Glasses, do I really need to write more than that?

$11.99Details


The Hungover Cookbook

Learn to cure your hangover with these delicious recipes!

$10.00Details


12 Gauge Shot Glass

Fire off a few rounds with our set of 12 Gauge Shot Glasses.

$17.95Details

Vinturi Essential White Wine Aerator

Specially designed to aerate white wine and produce better bouquet, enhanced flavors and smoother finish

$42.89Details


Fred and Friends Hopside Down Glass

Hopside Down, is that pun not enough of a description?

$20.00Details

Tailgate Folding Wooden Picnic Table

Have a picnic anywhere with the comfort of your own personal picnic table.

$134.99Details


Clear Blue Hawaii Molokini 2 - Person Kayak

Transparent Molokini Kayak. Discover. Explore. See. Witness fascinating lake or sea life through the sleek transparent hull. This is a great investment whether your goal is serious research or a child's voyage of discovery.

$2,243.17Details

About Face 3: The Essentials of Interaction Design

This completely updated volume presents the effective and practical tools you need to design great desktop applications, Web 2.0 sites, and mobile devices. This book will teach you the principles of good product behavior.

$45.00Details


Don't Make Me Think: A Common Sense Approach to Web Usability, 2nd Edition

100,000 copies sold. If you do anything web related, this book is a must read.

$40.00Details

The Design of Everyday Things

Anyone who designs anything to be used by humans--from physical objects to computer programs to conceptual tools--must read this book, and it is an equally tremendous read for anyone who has to use anything created by another human.

$15.95Details


Sport-Brella Umbrella Chair, Blue

Tired of all the shady spots being taken? Bring your own chair and shade together!

$39.99Details

Glow Graffiti Toolset - Paint with Light

It's the dead of night; everyone is tucked up in bed and the owls are-a-hooting. So it's time to break out the Glow Graffiti!

$34.99Details


Flash Cooking System Sapphire Blue 000 by JETBOIL

Designed to capture and focus heat more efficiently than traditional cooking systems, the Flash brings two cups of water to a boil in only two minutes.

$80.71Details

SHOT GLASS ICE MOLD (13PC. SET)

Take the chill off your next soiree when you serve guests a shot in an edible frozen glass.

$14.99Details


Fasta Pasta The Microwave Cooker

No waiting for a big pot of water to boil. Cook pasta to al dente perfection in the microwave! Saves time, energy and water.

$8.99Details

MIU France Zinc Alloy Connoisseur Corkscrew Wine Opener

The next best thing to an in-house sommelier, this professional-quality wine opener offers the same impressive performance and stylish design as corkscrews that cost far more.

$20.99Details


Pwned Mug

PWNED.

$9.99Details

Thermos Stainless King SK1005MB4 16-Ounce Leak-Proof Travel Mug, Midnight Blue

The ultra-durable, leak-proof Thermos Stainless King travel mug features an unbreakable stainless steel interior and exterior, making it a great companion for use in rough-and-tumble situations such as construction sites, delivery work, and more.

$19.43Details


Annie Hall

Annie Hall is one of the truest, most bittersweet romances on film.

$10.49Details

Manhattan

Manhattan is a wry, touching and finely rendered portrait of modern relationships against the backdrop of urban alienation.

$14.49Details


3M Self Adhesive Dry Erase Material. 24"" x 10-Feet Long.

Turn any wall into a dry erase board.

$12.50Details

Hydrofarm HGTL Thirsty Light Original Digital Indoor Plant Moisture Sensor

When a plant's soil becomes dry, the LED on the Thirsty Light blinks to let you know.

$9.15Details


Steve Jobs

Autobiography of Steve Jobs

$17.87Details

Can You Imagine 2320 Melting Clock

A Dali-eque functioning clock.

$14.99Details


IMCG Fridge Monkey - Charcoal

Bottles, Cans and drinks in general shouldn't fall out of the fridge ever again.

$7.99Details

Sea To Summit Ultra-Sil Daypack

Backpack that fits on a keychain.

$26.96Details


Looxcie Wearable Bluetooth Camcorder System, Android Compatible (Black)

Record what you're seeing directly to your phone.

$199.00Details

Das Boot

Das Boot.

$34.99Details


Gerber 31-000751 Bear Grylls Survival Series Ultimate Knife, Serrated Edge

Intricately designed by Gerber and Bear, it's loaded with innovations that won't be found in any other fixed blade knife. Like everything in the Survival Series, it also includes Bear's Priorities of Survival pocket guide.

$42.13Details

iMPROV Electronics 8.5" Boogie Board Tablet

You can utilize this writing tablet for home, office or school activity and you will never need a paper or pencil again.

$34.95Details


Aperture Science Mug

Welcome to Aperture Laboratories, A Trusted Friend in Science!

$12.99Details

PostSecret: Extraordinary Confessions from Ordinary Lives

A global phenomenon, exposing our individual aspirations, fantasies, and frailties -- our common humanity.

$17.68Details


Fred Cool Jazz Ice Cube Tray

It is time to kick back and chill and here is a cool way to do it! Drop one of these groovy guitars into your drink, and give it a stir. Just the thing for jazzing up your favorite beverage.

$7.99Details

True Fabrications Chain Bottle Rack

Use the magic chain to proudly show your wine anywhere. Simply put a bottle through the loop and let the chrome plated steel chain do the rest.

$24.95Details


Lightphoria 10,000 lux SAD Light Therapy Pad (Seasonal Affective Disorder) Sunlight Simulator. 2011 model (v2.1)

Bright light has been used for over a decade to alleviate symptoms associated with Seasonal Affective Disorder (SAD), jetlag, shift work fatigue, insomnia, seasonal change and more.

$99.99Details

Joby GP1-E1EN Gorillapod Flexible Tripod (Grey)

Gorillapod lets you mount your camera just about anywhere you want so that you can include everyone in your automatic shots.

$14.26Details


Lush Life Party Ice Luge

Let the fun begin when your pour your favorite drink down the luge.

$22.50Details

Adagio Teas 16-Ounce Ingenuitea Teapot

Great for the office or when traveling, this innovative teapot releases infused tea into a drinking cup. When tea is ready, simply place it atop the cup, causing a valve at the bottom to release and crystal-clear tea to flow down.

$17.45Details


Midnight in Paris

This is a romantic comedy set in Paris about a family that goes there because of business, and two young people who are engaged to be married in the fall have experiences there that change their lives. It's about a young man's great love for a

$17.99Details

Fred and Friends PIBOSS Pizza Boss Pizza Wheel

Sick of cutting pizza with a knife? Tired of cutting yourself with a pizza cutter?

$15.00Details


iHome iHM60LT Rechargeable Mini Speaker (Blue Translucent)

The iHM60 is an amazing approach to audio that offers size defying sound. Speaker connects to a computer or other USB power source via the included USB cable to recharge the internal lithium ion battery.

$19.99Details

Cute Fire Extinguisher Lighter With LED Light

Irony is always in style, right? Light up with this extinguisher.

$9.00Details


Satechi CR -3600 car holder mount for iPhone 4S, 4, 3G & 3GS, BlackBerry Torch, HTC EVO, DROID, Samsung EPIC on Windshield and Dashboard

Using a smartphone as a GPS? Mount it in your car properly just like a traditional GPS.

$29.99Details

Waterfi Waterproof iPod Shuffle 4th Generation 2GB - Underwater MP3 Player for Swimming & Water Sports! Waterproof Headphones Sold Separately

The Waterproof iPod Shuffle is the most versatile Waterproof MP3 Player available. You can listen to your favorite songs in high fidelity underwater in the pool, ocean, gym, snow, rain, and use it as your everyday MP3 Player!

$179.95Details


Big Mouth Toys Toilet Mug

A toilet bowl full of brown liquid, that's just tasteless. Or funny.

$10.97Details

Bananagrams

The Anagram game that will drive you bananas. The award-winning word game that needs no pencil, paper, or board. Fast and fun.

$14.95Details


Nintendo Wall Graphics - Super Mario Bros

Level up your room with this Mario Themed wall graphics.

$74.95Details

Blendtec Total Blender Four Side, Black

It’s an all-in-one appliance that makes smoothies, fresh juice, ice cream, milkshakes, cappuccinos, margaritas, soups, sauces, breads, dressings, salsas, and more.

$399.99Details


Cake Pop & Donut Hole Bakery

Make your own donut holes at home!

$24.99Details

Super Mario Time to Team Up 50-by-60-Inch Microraschel Throw Blanket

Mario and Luigi race to save the game surrounded by icons and characters from your favorite video game. Cuddle up in this warm throw for a long day of video game fun.

$29.99Details


Adjust-A-Cup 2-Cup Measuring Cup

Tired of having to deal with tons of different measurement cups and spoons? This elegant adjustable measuring cup solves everything.

$12.99Details

Credit Card Lightbulb

Never be afraid of the dark again. This mini light bulb is credit card size and can go with you anywhere.

$2.00Details


Weber 386002 Q 100 Portable Propane Gas Grill

The grill ignites at the push of a button for reliable lighting, and an infinitely adjustable burner valve with a high-quality regulator makes it easy to control the heat.

$134.24Details

Bladefish 5000 Powerfull Underwater Scooter

The BladeFish can get up to 3.75 mph and has a run time up to 2 hours.

$820.00Details


Sigma Beauty Flat Top Synthetic Kabuki - F80

This exclusive Flat Top Synthetic Kabuki was designed to deliver a flawless makeup application.

$23.38Details

Peekaru Original Fleece Baby Carrier Cover Medium - Black

Share the warmth with your baby or toddler. The Peekaru Original is an environmentally friendly fleece vest that fits over you and your baby, keeping you both warm without giving up the comfort of your favorite baby carrier.

$79.95Details


Diablo III

Shut up and take my money Blizzard.

$59.99Details

Exhaust Powered Car Jack

Jack your car up with the exhaust it's generating, simple and elegant car repair.

$224.98Details


Star Wars: The Old Republic

Star Wars: The Old Republic is a Massively Multiplayer Online Role-playing Game

$59.95Details

Mario Bros.: Koopa Shell Plush and Backpack

You never know when you need a turtle shell.

$39.95Details


Kinect Star Wars

Feel the Force as you transform yourself into a Jedi. Fully harnesses the power of the Kinect platform to deliver a natural and intuitive Star Wars experience.

$49.96Details

Obol, the Never-Soggy Cereal Bowl

Soggy cereal is a problem of the past.

$19.99Details


Victorinox Swiss Army Classic Pocket Knife

The Classic is the perfect pocket-size model, with seven functions, including tweezers and toothpick.

$17.50Details

Boon Glo Nightlight with Portable Balls, White

Boon Glo nightlight. Portable, don't heat up, turn off after 30 minutes and 95% effective at keeping monsters away all night long.

$84.99Details


Britax Frontier 85 Combination Booster Car Seat, Rushmore

The new Britax frontier 85 combination harness 2 booster boasts best in class forward-facing five-point harnessed weight capacity up to 85 pounds with an industry-leading 20" shoulder harness height.

$212.49Details


Bear Grylls Survival Series Ultimate Kit

The product of collaboration between Gerber and survival expert Bear Grylls, the Ultimate Kit is a 15-piece survival kit built for hostile environments.

$67.50Details

Swedish Firesteel - Army Model, Black Handle

Originally developed for the Swedish Department of Defense, Swedish FireSteel is a flash of genius. Its 3,000°C spark makes fire building easy in any weather, at any altitude.

$15.05Details


Men's Tetris Tie by Game Tie in Black

The classics of menswear and video games have finally come together to bring you this remarkable men's Tetris necktie.

$35.00Details

Umbra FishHotel Aquarium

Is your fish getting to old to live at home? This condo is the perfect balance of freedom and comfort for your beloved fish.

$38.50Details


Eagles Nest Outfitters DoubleNest Hammock (Orange/Grey)

The DoubleNest seats more than one person comfortably and is essential for family adventures. The DoubleNest still packs down to the size of a grapefruit, so there is no excuse to be without your ENO hammock.

$64.95Details

THE EX Kitchen Knife Set by Raffaele Iannello, Black

Not only functional, but also therapeutic, this five-piece knife set plus holder makes for the perfect gift and a guaranteed conversation piece.

$169.99Details


Philips Hf3470/60 Wake-up Light, White

This alarm turns a light on slowly to help you wake up. Clinically proven to make waking up more pleasant.

$99.99Details

8 Bit Tie

A reminder of better days.

$14.99Details


World Of Warcraft Deluxe Latex Mask, Troll, Green, One Size

Sometimes I wish I could roam around the mall like it were Azeroth. Now I can with my World of Warcraft Troll Mask!

$36.99Details

Emile Henry Flame Top Pizza Stone, Black

Create marvelous pizzas at home.

$50.00Details


Monkey Light Bike Light

A revolutionary bike light that keeps you visible! It features 32 of the brightest full color LEDs available, and cutting edge visual effects custom designed by our electronic artists.

$64.99Details


Tasting Beer: An Insider's Guide to the World's Greatest Drink

Everything you ever wanted to know about beer!

$16.95Details

Minecraft Diamond Earrings

Advertise your love for Minecraft with these rare gems! Here is a pair of gorgeous diamond earrings, straight from the depths of my private mine. Diamonds *are* a miner's best friend.

$10.00Details


3D Pig from Minecraft

Oink! Oink!

$20.00Details

Pelican 1170 Carrying Case for Multi-Purpose - Black

Hand-held electronics protection solution. Watertight, crushproof, and dust proof. Easy open Double Throw latches. Open cell core with solid wall design - strong, light . O-ring seal. Automatic Pressure Equalization Valve. Pick N Pluck with convoluted li

$34.24Details


Minecraft Diamond Tool/Weapon Magnet Set

Each magnet has at least one strong round magnet or bar magnet so they're not only fun but functional. See my shop for other Minecraft sets, including this one in iron and gold.

$10.00Details


Minecraft University Hoodie

Ad Gloriam et Porcos (For pigs and glory!)

$59.99Details


Moon of My Life - Swarovski Crystal AB Necklace

This necklace is inspired by words of endearment of Khal Drogo for Daenarys in George R. R. Martin's Game of Thrones, first book in the Song of Ice and Fire series.

$31.00Details

Minecraft Note Cube

Leaves no cobblestone residue once fully mined

$14.95Details


Winter is coming - Game of Thrones Unisex Cuff Bracelet

The hammered copper is accented by a rectangle of sterling silver that is stamped with the House of Stark motto "Winter is coming" from the George Martin Song of Ice and Fire series. The bracelet is then oxidized to give it a distressed look.

$45.00Details

Minecraft Sheet Magnets

80 1" square blocks on each sheet (2 sheets)

$21.53Details


Minecraft Drop it Creep Premium Tee S

A Creeper bounces his way up to an unsuspecting clerk, Give me all your money, bookworm, or I blow up your brainssssSSSsss!

$21.99Details

Cuisinart GR-4N 5-in-1 Griddler

Compact in size but big in features, Cuisinart's countertop Griddler offers five-in-one functionality as a contact grill, panini press, full grill, full griddle, and half grill/half griddle.

$80.25Details


Minecraft Foam Pickaxe

The Minecraft Foam Pickaxe is made from sturdy EVA foam, which means that unlike the stone pickaxe in the game, the Minecraft Foam Pickaxe will withstand far more than 132 uses.

$49.99Details

Minecraft Creeper Anatomy T-Shirt

The Creeper (Creepus explodus) is an all-terrain combustible terror of destruction, indigenous to dark caves found deep beneath the earths crust, and luxurious neighborhoods with glass houses and nice fancy everythings.

$19.99Details


Presto Pro EverSharp Electric Knife Sharpener

Razor sharp knives whenever you want - easy, automatic. Professional two-stage system sharpens in seconds. Blade guides automatically hold knife at ideal sharpening angle.

$27.00Details

Minecraft Confused Shirt

We presume that to a denizen of Minecraft spheres would be sort of like what non-Euclidean geometry is to us.

$19.99Details


AeroGarden 2101-00B Classic Garden 7-Pod With Gourmet Herb Seed Kit - Black

Enjoy the taste and fragrance of fresh herbs, vegetables and salad greens grown right in your kitchen. The AeroGarden grows them all with no dirt, mess or pesticides.

$149.95Details

Minecraft Creeper T-Shirt

Embrace your inner Creeper!

$19.99Details


StarCraft II: Heart of the Swarm (Pre-Order)

Heart of the Swarm expansion for Starcraft 2

$59.99Details

Eat Sleep Minecraft T-Shirt

Eat, Sleep Minecraft

$23.52Details


Razer Marauder StarCraft II Gaming Keyboard

The Razer Marauder StarCraft II gaming keyboard is a full featured, tournament ready keyboard with an extremely compact design.

$98.35Details


Razer Banshee StarCraft II Gaming Headset

With its circumaural design the Razer Banshee is designed for optimal sound isolation to allow you to focus completely on your game.

$100.23Details

Sir Creeper of Minecraftia

Sir Creeper is a lover of all things expensive, and your newly acquired diamond is looking really good to him right now.

$24.54Details


Razer Spectre StarCraft II Gaming Mouse

Razer Spectre StarCraft II gaming mouse is a lightweight, five button mouse that is ideal for gamers that prefer precision and control for an RTS.

$63.11Details

Don't Fear the Creeper (Sticker)

There's nothing to fear, all he has is an explosive personality!

$2.40Details


Razer StarCraft II Zerg Edition Messenger Bag

The Starcraft II Zerg Edition Messenger Bag is designed for gamers who want to keep their gear protected, stay comfortable, and look good doing it.

$59.77Details

Skull & Pickaxes (Sticker)

The traditional Skull & Crossbones with an added Minecraft twist!

$2.40Details


Starcraft II 2 Dog Tag USB 2gb drive James Jim Raynor

Starcraft 2 Dogtag USB Stick ensures you're the coolest kid at the lan party.

$90.00Details

Got Wood?

T-Shirt (Also available as Hoodie)

$24.54Details


The StarCraft Bible 2nd Edition: Who knew that explosions of pixels could inspire?

This is the history of StarCraft. This is the love of e-sports. This is the Bible of StarCraft.

$16.99Details

Creeper Mousepad

You'll receive one cloth topped mousepad that is backed with non-slip, non-marking rubber.

$12.00Details


Minecraft Diamond Ring

The ring is adjustable, and the figure is made from Polymer clay. It is painted with acrylic paint and finished with Min-Wax polycrylic to seal and protect it.

$10.00Details


Minecraft inspired Grass Cube Tissue Box Cover

Save your desk or nightstand from those ugly cardboard tissue boxes!

$18.00Details

All American 921 21-1/2-Quart Pressure Cooker/Canner

This heavy-duty pressure cooker's large capacity is probably best utilized for canning (though it would also be great for a number of cooking tasks).

$199.99Details


Game of Thrones 11x17 HD Photo Poster HBO Tv Series #05

Tyrion Lannister (Peter Dinklage) Game of Thrones poster.

$11.99Details


Needle, Sword of Arya Stark. Licensed from George R.R. Martin's "A Song of Ice and Fire."

Lighter, thinner, and smaller than a typical Westeros blade, the style was closer to that of Braavos across the Narrow Sea, to be used for thusting and slashing, style of combat more suited to the quick and agile, rather than those with raw strength.

$199.95Details

Fierce as a Wolverine - Arya Stark Aluminum Cuff Bracelet

It is hammered on the edges and ends and stamped with one of Arya Stark's Braavosi mantras--"fierce as a wolverine"--from Game of Thrones, the first in the fantasy series "Song of Ice and Fire" by George R. R. Martin. The text is

$21.00Details


Iron Throne Paperweight

Keep your papers secure with this Iron Throne paperweight.

$59.99Details

Apple Macbook Laptop Game of Thrones Stark Decal

Apple Macbook Game of Thrones Stark Decal

$7.99Details


Game of Thrones Night's Watch Oath Mug

I am the watcher on the walls.

$14.99Details

Game Of Thrones Movie Poster 24x36in

Game of Thrones Poster Print

$19.97Details


Game of Thrones Khaleesi Women's T-Shirt

The Game of Thrones Khaleesi t-shirt symbolizes the power the Khaleesi has over the toughest of all warriors.

$24.99Details


Game of Thrones Dragon Egg Necklace

Among Daenerys' most prized possessions are the three petrified dragon eggs gifted to her upon marrying Khal Drogo, immortalized here with the Game of Thrones Dragon Egg Necklace.

$69.99Details


Game of Thrones House Lannister Shot Glass

One of the richest and most powerful families of Westeros is honored on this Game of Thrones House Lannister Shot Glass.

$6.99Details

Game of Thrones Art Print - Stick 'Em With The Pointy End

What's the first lesson of sword fighting? This print was inspired by everyone's favorite little mischief maker, Arya Stark. It features the Stark house colors, grey and white with an image of Needle at the top.

$15.00Details


Game of Thrones House Stark Phone & MP3 Player Skins

For a Great House that can claim a line of descent stretching back over eight thousand years, this Game of Thrones House Stark Phone & MP3 Player Skin has a lot to live up to.

$14.99Details

Game of Thrones: The Complete First Season

Game of Thrones Season 1 DVD

$44.99Details


Game of Thrones Stark Ring

Engraved with the House Stark emblem of a direwolf, the Game of Thrones Stark Ring will let your enemies know where your loyalties lie.

$29.99Details

A Game of Thrones: The Card Game

The A Game of Thrones card game can be played in a multiplayer melee format with 3-4 players, or in a one-on-one joust format with 2 players.

$22.49Details


Game of Thrones Robb Stark T-Shirt

Show your loyalty to the House Stark with the Game of Thrones Robb Stark T-Shirt.

$24.99Details

A Game Of Thrones

With this fantastic board game, players can enter the world of George R. R. Martin's best-selling A Song of Ice and Fire fantasy series and take control of one of the great houses of Westeros. Using warfare, diplomacy, and treachery, players vie for

$59.99Details


Game of Thrones Khal Drogo T-Shirt

Khal Drogo, powerful Dothraki chieftain and leader of the largest khalasar in the Dothraki Sea, has proven undefeated in Game of Thrones.

$24.99Details

Game of Thrones World Map

Map of Westeros, Essos & Valyria.

$20.00Details


Game of Thrones House Lannister Wall Plaque

Show your allegiance to the Lannisters with a house banner. Fair haired, tall and handsome, the Lannisters are the blood of Andal adventurers who carved out a mighty kingdom in the western hills and valleys.

$34.99Details

Game of Thrones

Soundtrack from Game of Thrones

$15.34Details


House Targaryen Leather iPod Case

A leather iPod Touch case featuring the symbols of House Targaryen embossed on the cover - a three headed dragon raised up in attack.

$35.00Details

Game of Thrones Patches, Song of Ice and Fire, FULL SET

These patches features my interpretation of the coats of arms of the six major houses from George R. R. Martin's "A Song of Ice and Fire" series -- Stark, Lannister, Baratheon, Targaryen, Greyjoy, and Tully.

$48.00Details


Game of Thrones Bookmark: Jon Snow

This bookmark features Jon Snow and his direwolf, Ghost. It is 2.5"x6", digitally printed on heavyweight paper and UV-coated. Watermark will not appear on the bookmarks.

$3.00Details

The George R.R. Martin Song Of Ice and Fire Hardcover Box Set featuring A Game of Thrones, A Clash of Kings, A Storm of Swords, and A Feast for Crows (Amazon Exclusive)

George R. R. Martin has created a world that is as rich and vital as any piece of historical fiction, set in an age of knights and chivalry and filled with a plethora of fascinating, multidimensional characters that you love, hate to love, or love to hat

$86.31Details


A Dance with Dragons: A Song of Ice and Fire: Book Five

In the aftermath of a colossal battle, the future of the Seven Kingdoms hangs in the balance once again--beset by newly emerging threats from every direction.

$17.48Details


Steampunk Ring Aria Lilac - Eye of the Dragon - Game of Thrones

Vintage, Recycled, and Unique Handmade and Handcrafted, Gemstone, Crystal and Pearl Jewelry

$45.00Details

Steampunk Ring - Game of Thrones Inspired Eye of the Dragon Wire Wrapped Lampwork

Steampunk is so inspiring and original. I love the twists and turns in these rings. Every ring is one of a kind with Custom Artisan Lampwork Boro Glass Beads. The artist that creates them is a great friend of mine and is so knowledgeable about glass work

$45.00Details


King Robert's Warhammer

Rhaegar fought valiantly, Rhaegar fought nobly, Rhaegar fought honorably. And Rhaegar died.

$270.00Details

A Song of Ice and Fire 2012 Wall Calendar

A Song of Ice and Fire Wall Calendar: With stunning all-original artwork from John Picacio-one of the genre's most popular artists.

$14.99Details


Ice, Sword of Eddard Stark, Damascus Edition

If you would take a man's life, you owe it to him to look into his eyes and hear his final words. And if you can not do that, then perhaps the man does not deserve to die.

$700.00Details

Game of thrones Dark T-Shirt by CafePress

Winter is Coming. Maybe it's already here. Get a T-Shirt!

$27.00Details


Young Robert Baratheon

This would be from around the time of the Battle of the Ruby Ford.

$9.99Details


Game of Thrones Tyrion Lannister Men's T-Shirt, Medium

Tyrion Lannister T-Shirt. Surely this won't increase your debt much.

$17.99Details


Audio-Technica ATH-M50 Professional Studio Monitor Headphones

One of the most popular headphone sets in existence. Designed for DJs/Producers, they are fantastic for anyone.

$159.00Details


Longclaw, Sword of Jon Snow. Licensed from George R.R. Martin's "A Game of Thrones"

For five centuries the Valyrian steel sword Longclaw was carried by the Lords of Bear Island in the service of the Starks of Winterfell.

$249.95Details

Bling Jewelry Sterling Silver Elongated Teardrop Bangle Bracelet

This bracelet is great for every day wear and elegant for dressy affairs.

$49.99Details


Sweet Valley Confidential: Ten Years Later

Jessica and Elizabeth Wakefield are back and all grown up, dealing with the complicated adult world of love, careers, betrayal, and sisterhood.

$8.80Details

Glow in the Dark Toilet Roll

Don't like turning the light on when you need an impromptu midnight wee? Your aim may be rubbish, but at least you can find the toilet paper thanks to our Glow in the Dark Toilet Roll!

$7.60Details


Stainless Steel Aqua Resin Dome Ring

Beautiful Stainless Steel Aqua Resin Dome Ring

$31.99Details

Fred & Friends Beat It Chopsticks Set

One end of each chopstick is a regualr chopstick shape while the other end of of the chopstick is in the shape of a drumstick.

$14.99Details


Bodum Brazil 8 cup French Press Coffee Maker, 34 oz, Black

Bodum Brazil offers a classic take on modern, functional design that will never go out of style.

$16.99Details

Kindle Fire, Full Color 7" Multi-touch Display, Wi-Fi

Kindle Fire isn't just for books anymore. Web, Apps, Video, Magazines, Music and More!

$199.00Details


Hops Holster 12 Can Ammo Pack

When you're ready to wage war on thirst (and possibly sobriety) the Hops Holster 12 Can Ammo Pack is the only beer holder gear you need.

$39.95Details

Wii Classic Controller Pro - Black

Created for accessibility and comfort, the Classic Controller Pro blends design elements from game systems such as the NES, Super NES, and Nintendo 64 providing seamless play control for a wide range of games.

$19.99Details


Indian Healing Clay - 2 lbs - Clay

Aztec Secret Indian Healing Clay deep cleanses skin pores, removing dirt and impurities, lifting out poisons and toxins stored in the epidermis.

$7.52Details

Vera Bradley Knot Just a Clutch Bag in Bali Gold

A new Clutch to added to the collection. Has a beautiful knoted design on the front.

$39.00Details


Henry Darger

This large-format, lavishly illustrated volume presents the iconic American outsider artist in a new critical light, locating him for the first time as a major figure in the history of contemporary art.

$53.55Details

Vera Bradley Convertible Kisslock in Lemon Parfait

A wallet by day and a purse by night, this convertible accessory is fun, flirty and large enough to hold a Smartphone.

$27.95Details


Lumisource NESSIE Table Desk Lamp

Inspired by Nessie the Lochness Monster, this light keeps your kids company and is fun to play with.

$45.00Details


Metal Jewelry Stand Tree with an Antique Silver & Gold Finish

Iron Jewelry Tree Stand Unique tree design with leaves and branches Done in an antique silver/gold finish Works great for necklaces and bracelets and has 40 hanging positions

$23.99Details

Elephant Ring Holder - Silver

Store your rings on this adorable elephant's trunk.

$24.99Details


Halo 3, Master Chief Costume, Adult Standard

Quilted jumpsuit with EVA armor, two-piece deluxe helmet, gauntlets and boot tops.

$580.46Details

Black Light Reactive Neon Makeup with Black Light Pendant (Yellow)

This awesome UV make up kit allows you to add neon flare to your boring every day make up.

$6.99Details


Kate Spade iPhone 4 Tropical

This fun striped pattern is done in bold shades of lavender, yellow-gold,blue, fuschia, pink and lime.

$25.00Details

Smart Planet CDM-1 Corn Dog Maker

Make your very own corn dogs

$24.99Details


Ten One Design Fling Game Controller - Ninja

Fling is a tactile game controller for iPad.

$9.50Details

Helter Skelter Drinks Chiller

Warm drinks are so 20th century.

$33.18Details


Mr. Beer Premium Gold Edition Home Brew Kit

A great starting point for a beginning and intermediate brewers, it includes two of Mr. Beer's most popular beer mixes as well as everything needed to both brew and bottle your first 2 batches of top-quality beer.

$59.99Details

Mindflex Duel Game

Mindflex Duel is the ultimate head-to-head brain game challenge

$74.99Details


Lilly Pulitzer iPad & Netbook Sleeve - Nice To See You

Protect your iPad/NetBook in style.

$29.95Details

Tea Sub - Yellow Submarine Tea Infuser

We all live in a yellow submarine, a yellow submarine,a yellow subm...

$10.81Details


Think Geek Star Trek Enterprise Pizza Cutter

Boldly go where no pizza has gone before with Think Geek's Star Trek Pizza Cutter.

$24.99Details

Learning Resources Zoomy Handheld Digital Microscope

Amazing all-in-one digital microscope takes scientific inquiry to a new level - yet is easy for even a young child to use.

$59.95Details


Back to Basics TEM500 Egg-and-Muffin 2-Slice Toaster and Egg Poacher

The Egg & Muffin Toaster brings innovation to the toaster category by combining the functions of a toaster and an egg poacher into one easy-to-use appliance.

$34.00Details

OPI Nail Polish You Don't Know Jacques! 0.5 oz.

Beautiful nails are always in style.

$8.09Details


Swimline Kickback Adjustable Lounger, Double

The Swimline KickBack Double Adjustable Lounger features infinite adjustability and ultimate comfort for two.

$79.99Details

Chillow ® Comfort Device

The Chillow® is a noiseless, low-cost cooling alternative that is environmentally friendly

$23.95Details


Sense and Sensibility

Jane Austen's most famous novel. It's about the necessity of finding a workable middle ground between passion and reason.

$9.99Details

OPI NAIL POLISH - MRS O'LEARY'S BBQ #W44

Beautiful nails are always in style.

$2.75Details


Something to Read on the Plane

A delightfully light-hearted variety of stories, articles, limericks, and even a quiz to see how good a passenger you are.

$0.99Details

Anna Karenina

There is no doubt that Anna Karenina, generally considered Tolstoy's best book, is definitely one ripping great read.

$24.99Details


OPI Teenage Dream-Katy Perry Polish

Beautiful nails are always in style.

$8.99Details

Swiss+Tech UKCSB-1 Utili-Key 6-in-1 KeyChain MultiTool

The lightest and most compact multi-use tool ever developed.

$7.50Details


Madame Bovary

A story of a woman trapped in a loveless marriage in 19th century France.

$18.49Details

OPI Silver Shatter Nail Polish NL E62

Beautiful nails are always in style.

$6.49Details


Fred and Friends OCD Cutting Board

Cut everything to perfection.

$25.00Details

Numi Organic Tea Flowering Gift Set in Handcrafted Mahogany Bamboo Chest: Glass Teapot & 6 Flowering Tea Blossoms

Packaged in an exotic hand-made dark mahogany bamboo case, this Flowering Gift Set is filled with six bouquets of tea leaves that blossom into a myriad of flavors from sweet and subtle to rich and bold.

$21.75Details


The Portrait of a Lady (Penguin Classics)

A story of intense poignancy, Isabel's tale of love and betrayal still resonates with modern audiences.

$12.00Details

Michael Kors Perfume for Women 1 oz Eau De Parfum Spray

Creamy florals explode into exotic spices, tamed by Moroccan incense. A fragrant creation with a wealth of personality that will capture the heart of every woman.

$69.99Details


Pet Umbrella (Dog Umbrella) Keeps your Pet Dry and Comfotable in Rain

Keep your pet happy and dry in rain, sleet or snow!

$14.95Details

Presto 03430 Pizzazz Pizza Oven

The fast and easy way to bake fresh or frozen pizza. Great for frozen, homemade, take-and-bake, or deli pizza. The easy way to prepare chicken nuggets, quesadillas, fish fillets, even grilled sandwiches.

$39.96Details


Drinkwell Platinum Pet Fountain

Pet water fountain.

$44.06Details

Flowerbomb by Viktor & Rolf for Women - 3.4 Ounce EDP Spray

Launched by the design house of Viktor & Rolf.

$109.14Details


Better Sleep Pillow - A Multi Position Pillow for Side Sleepers, Stomach Slee...

Now you can enjoy the benefits of the most comfortable multi-functional doctor-approved pillow.

$99.99Details

Magic Bullet MBR-1701 17-Piece Express Mixing Set

The magic bullet replaces a food processor, blender, and coffee grinder. Yet it occupies only the space of a coffee mug.

$38.49Details


Trish Mcevoy No. 9 Blackberry & Vanilla Musk

TRISH MCEVOY NO. 9 BLACKBERRY & VANILLA MUSK by Trish McEvoy

$48.00Details

Roulette Shot Glass Bar Drinking Game Set

The party starts when the ball stops rolling!

$29.99Details


The Picture of Dorian Gray

Dorian Gray, a handsome young man, receives a beautiful painting of himself from his good friend Basil Hallward. In the same moment, a new acquaintance, Lord Henry, introduces Dorian to the ideals of youthfulness and hedonism, of which Gray becomes immed

$6.95Details

Flawless Sterling Silver Floating Heart, 13/16" X 13/16"

Beautiful Floating heart. Solid Sterling Silver, Excellent mirror like finish.

$79.95Details


Nikon D5000 12.3 MP DX Digital SLR Camera with 18-55mm f/3.5-5.6G VR Lens and 2.7-inch Vari-angle LCD

A remarkable blend of simplicity and highly-advanced DSLR capabilities, the compact and powerful D5000 offers breathtaking 12.3-megapixel image quality, along with a flexible, Vari-angle, Live View monitor for fresh picture-taking perspectives.

$769.95Details

Letters to a Young Poet

Those looking for an alluring image of the solitary artist--and for an astonishing quotient of wisdom--will find both in Letters to a Young Poet.

$4.99Details


Satya Jewelry Silver Turquoise, Hamsa, Lotus Charm Necklace

Turquoise, the stone of healing, and the Hamsa which protects against negative energies, meet the lotus as a symbol of renewal and transformation.

$98.00Details

10 Sky Lanterns - White

Celebrate a special occasion with these amazing sky lanterns.

$28.99Details


Bling Jewelry Sterling Silver Turquoise Five-strand Bracelet [Jewelry]

Five strands of hand-strung turquoise nuggets are attached to a .925 sterling silver bar clasp.

$39.99Details

Kurt S. Adler 10-Light Star Wars R2D2 Light Set

This novelty light set features 10 R2D2 lights with 30-inch lead wire and 12-inch spacing.

$30.00Details


© Gift Lizard 2011