×

Find gifts by describing the person you are trying to buy for. Use things like who they are (dad), their hobbies (star wars), their personality (geek, gamer).

You searched for: star warsgreencupbeerbathroombachelorwomenpetsfoodcampingfireflydrinkingscience

Reset Tags. (Click a tag to remove it. Add tags on the left side.)

The Hungover Cookbook

Learn to cure your hangover with these delicious recipes!

$10.00Details

Kikkerland Skull Shot Glasses, Set of 4

Skull Shot Glasses, do I really need to write more than that?

$11.99Details


Fred and Friends Hopside Down Glass

Hopside Down, is that pun not enough of a description?

$20.00Details


12 Gauge Shot Glass

Fire off a few rounds with our set of 12 Gauge Shot Glasses.

$17.95Details

Fred Cool Jazz Ice Cube Tray

It is time to kick back and chill and here is a cool way to do it! Drop one of these groovy guitars into your drink, and give it a stir. Just the thing for jazzing up your favorite beverage.

$7.99Details


Lush Life Party Ice Luge

Let the fun begin when your pour your favorite drink down the luge.

$22.50Details

SHOT GLASS ICE MOLD (13PC. SET)

Take the chill off your next soiree when you serve guests a shot in an edible frozen glass.

$14.99Details


Das Boot

Das Boot.

$34.99Details

Jedi Dressing Gowns - Star Wars Bath Robes

Those aren't the droids you're looking for.

$88.44Details


Mr. Beer Premium Gold Edition Home Brew Kit

A great starting point for a beginning and intermediate brewers, it includes two of Mr. Beer's most popular beer mixes as well as everything needed to both brew and bottle your first 2 batches of top-quality beer.

$59.99Details

True Fabrications Chain Bottle Rack

Use the magic chain to proudly show your wine anywhere. Simply put a bottle through the loop and let the chrome plated steel chain do the rest.

$24.95Details


Helter Skelter Drinks Chiller

Warm drinks are so 20th century.

$33.18Details

LEGO Star Wars Ultimate Collector's Millennium Falcon

Han Solo's famous starship is crafted from over 5,000 Lego pieces.

$499.99Details


Hops Holster 12 Can Ammo Pack

When you're ready to wage war on thirst (and possibly sobriety) the Hops Holster 12 Can Ammo Pack is the only beer holder gear you need.

$39.95Details

Bath Tissue Tyrant: Commode Dragon

Some dragons are helpful. Rest peacefully knowing this dragon is guarding the most important thing in the room.

$34.95Details


Bear Grylls Survival Series Ultimate Kit

The product of collaboration between Gerber and survival expert Bear Grylls, the Ultimate Kit is a 15-piece survival kit built for hostile environments.

$67.50Details


MANGROOMER Do-It-Yourself Electric Back Hair Shaver

The Mangroomer Do-It-Yourself Electric Back Shaver is absolutely the best way to get rid of unwanted back hair.

$39.99Details

Tasting Beer: An Insider's Guide to the World's Greatest Drink

Everything you ever wanted to know about beer!

$16.95Details


Small 4" Round EcoSphere

A perfectly balanced ecosystem that fits on your desk.

$101.53Details


Big Mouth Toys Toilet Mug

A toilet bowl full of brown liquid, that's just tasteless. Or funny.

$10.97Details

Fasta Pasta The Microwave Cooker

No waiting for a big pot of water to boil. Cook pasta to al dente perfection in the microwave! Saves time, energy and water.

$8.99Details


Indian Healing Clay - 2 lbs - Clay

Aztec Secret Indian Healing Clay deep cleanses skin pores, removing dirt and impurities, lifting out poisons and toxins stored in the epidermis.

$7.52Details


Adagio Teas 16-Ounce Ingenuitea Teapot

Great for the office or when traveling, this innovative teapot releases infused tea into a drinking cup. When tea is ready, simply place it atop the cup, causing a valve at the bottom to release and crystal-clear tea to flow down.

$17.45Details

Pleo Dinosaur - A UGOBE Life Form

Pleo looks, moves, sounds and behaves like a living creature. Fully aware and cognitive, he explores his environment and interacts with people, accessories and other UGOBE dinosaurs.

$508.08Details


Cuisinart GR-4N 5-in-1 Griddler

Compact in size but big in features, Cuisinart's countertop Griddler offers five-in-one functionality as a contact grill, panini press, full grill, full griddle, and half grill/half griddle.

$80.25Details

MIU France Zinc Alloy Connoisseur Corkscrew Wine Opener

The next best thing to an in-house sommelier, this professional-quality wine opener offers the same impressive performance and stylish design as corkscrews that cost far more.

$20.99Details


AeroGarden 2101-00B Classic Garden 7-Pod With Gourmet Herb Seed Kit - Black

Enjoy the taste and fragrance of fresh herbs, vegetables and salad greens grown right in your kitchen. The AeroGarden grows them all with no dirt, mess or pesticides.

$149.95Details

PUR 18 Cup Dispenser with One Pitcher Filter DS-1800Z

Keep your water clear of chemicals and odors with this dispenser from PUR. Its advanced filtration system reduces more contaminants (lead, copper, zinc, etc.) than any other pour-through filter.

$27.81Details


Numi Organic Tea Flowering Gift Set in Handcrafted Mahogany Bamboo Chest: Glass Teapot & 6 Flowering Tea Blossoms

Packaged in an exotic hand-made dark mahogany bamboo case, this Flowering Gift Set is filled with six bouquets of tea leaves that blossom into a myriad of flavors from sweet and subtle to rich and bold.

$21.75Details

Sea Kelp / Moss with Chamomile Herb and Cocoa Butter Soap

The seaside scent in this natural beauty facial and body soap coupled with the invigorating hint of cocoa butter will make you feel like you are relaxing by the ocean.

$9.50Details


Fascinations AntWorks Illuminated Blue

Study the life-cycle of ants in this space-age gel habitat 3-dimensional ant city in the making.

$28.49Details

Tea Sub - Yellow Submarine Tea Infuser

We all live in a yellow submarine, a yellow submarine,a yellow subm...

$10.81Details


Roulette Shot Glass Bar Drinking Game Set

The party starts when the ball stops rolling!

$29.99Details

Obol, the Never-Soggy Cereal Bowl

Soggy cereal is a problem of the past.

$19.99Details


Shower Shock Caffeinated Soap

the original and world's first caffeinated soap from ThinkGeek. When you think about it, ShowerShock is the ultimate clean buzz ;)

$6.99Details


Glow in the Dark Toilet Roll

Don't like turning the light on when you need an impromptu midnight wee? Your aim may be rubbish, but at least you can find the toilet paper thanks to our Glow in the Dark Toilet Roll!

$7.60Details

IMCG Fridge Monkey - Charcoal

Bottles, Cans and drinks in general shouldn't fall out of the fridge ever again.

$7.99Details


Stimulo Cat Feeding Station and Activity Center

Make your cats work for their food.

$24.92Details

Zen Magnets - Gift and Retail Packed Zen Set

Zen Magnets. These super powerful and tiny magnets are a lot of fun for kids and adults.

$59.95Details


Boyfriend Pillow

Want to cuddle but nobody is around? The boyfriend pillow will hold you, every night, all night.

$60.00Details

Handcrafted Figured Mahogany Case for iPhone 4/4S

Protect your phone with classic style.

$69.95Details


Gear Wall Art with Clock

Perfect for the mechanically inclined person in your life. Perfectly balanced between art and utility.

$140.00Details

Fred and Friends PIBOSS Pizza Boss Pizza Wheel

Sick of cutting pizza with a knife? Tired of cutting yourself with a pizza cutter?

$15.00Details


Bonsai Boy's Redwood Bonsai Tree - 5 Tree Forest Group metasequoia glyptostroboides

Ever want your own personal redwood forest? Now you can have this beautiful 5 tree in your home garden.

$225.00Details

Nintendo Wall Graphics - Super Mario Bros

Level up your room with this Mario Themed wall graphics.

$74.95Details


Vibram Fivefingers KSO

Run around like you don't have shoes on and still enjoy the protection of having shoes!

$85.00Details


Norpro Nonstick Cake-Sicle Pan with 24 Sticks

I wish I had thought of this. Cakesicles. mmmm.... delicious

$19.99Details

Modern Single Handle Waterfall Bathroom Vanity Vessel Sink LED Faucet, Chrome

This amazing LED faucet changes color with the temperature of the water.

$59.99Details


Cake Pop & Donut Hole Bakery

Make your own donut holes at home!

$24.99Details

Wookiee Cookies: A Star Wars Cookbook

Tusken Raider Taters, Yoda Soda, C-3PO Pancakes... mmmm sounds delicious!

$18.99Details


Tailgate Folding Wooden Picnic Table

Have a picnic anywhere with the comfort of your own personal picnic table.

$134.99Details

Kotobukiya Samurai Sword Chopsticks Set: Date Masamune

The way of the warrior starts at the dinner table! Based off of real samurai warriors! Meals with honor!

$11.99Details


World's Largest Giant Gummy Bear Cherry

Sometimes I just crave a gummy bear steak.

$29.15Details

Mario Bros.: Koopa Shell Plush and Backpack

You never know when you need a turtle shell.

$39.95Details


Men's Tetris Tie by Game Tie in Black

The classics of menswear and video games have finally come together to bring you this remarkable men's Tetris necktie.

$35.00Details

Star Wars Interactive R2D2

Dancing to Cantina Music, bringing you drinks and guarding your precious stuff. What more could you ask for from the most faithful robot in the galaxy?

$199.99Details


Umbra FishHotel Aquarium

Is your fish getting to old to live at home? This condo is the perfect balance of freedom and comfort for your beloved fish.

$38.50Details

Ninja Coat Hook

Hang up your coat Yakuza style! This Ninja Coat Hook will transform your entry way into a dangerous Tokyo alley.

$9.11Details


Cute Fire Extinguisher Lighter With LED Light

Irony is always in style, right? Light up with this extinguisher.

$9.00Details

Nostalgia Electrics SCM-502 Vintage Collection Old Fashioned Snow Cone Maker

This old-fashioned, carnival-style snow cone maker cart shaves ice cubes into snow. Add your choice of flavored syrup. Now you can enjoy the wonderful cool taste of Snow Cones anytime in the convenience of your own home.

$67.00Details


8 Bit Tie

A reminder of better days.

$14.99Details

Official Barney Stinson Armani Grey Suitjamas

A salute to the perfect gentlemen. Never not wear a suit again!

$99.99Details


USBCELL AA Rechargable Battery

Can't find your charger? USBCELL AA Rechargeable Batteries work just like normal rechargeable batteries--but simply pop off the lid to recharge by any powered USB Port.

$19.95Details

Bamboo Wirelesskeyboard & Mouse

Environmentally friendly keyboard and mouse combo

$142.09Details


BACON shaped themed Adhesive Bandages

Bacon Band Aids. Bacon really does fix everything.

$6.99Details

Kurt Adler SW6101L Star Wars Nutcracker, Storm Trooper, 11-Inch

This 11-inch nutcracker is based on a Storm Trooper from the popular Star Wars series.

$35.67Details


Star Wars Art Prints Boba Fett R2D2 and C-3PO Art 3D Pop Artwork Droid Art

This Star Wars Art prints listing is for paper cut 3-D pop artwork featuring the galaxy's favorite bounty hunter Boba Fett and inter-galactic best buddies: R2-D2 and C-3PO.

$67.00Details


LEGO Star Wars Millennium Falcon 7965

Straight from the Death Star escape scene of Episode IV: A New Hope

$126.99Details

Stormtrooper Regrets T-Shirt

Those WERE The Droids You Were Looking For

$16.99Details


Star Wars Science - Force Trainer

May the Force be with you! The Force Trainer by Uncle Milton actually allows you to control a Jedi Training Remote with your mind, by tapping into cutting-edge brainwave technology.

$35.95Details

Star Wars Dinnerware Plate and Bowl - 2 Piece Set

Package includes 1 plate and 1 bowl Plate size 8 inches in diameter, bowl size is 5.75 inches in diameter.

$4.51Details


Funko Darth Vader Bobble - Head

This mighty warrior will watch over your desk and enforce the emperor's will on all who dare draw near.

$10.07Details

Vandor 14 by 4 by 15-Inch Star Wars Large Recycled Shopper Tote, Multicolored

The Star Wars Large Recycled Tote is the perfect gift for any Star Wars fan.

$5.95Details


STAR WARS DOG hat costume yoda

Show your love of awesome things by dressing your furry monster up as Yoda this year!

$20.00Details

Flared Star Wars Skirt

One of a kind Skirt. Flared Style. With Knit Waistband. M Waist 30-38

$25.00Details


Adult R2-D2 Star Wars Beanie

Crocheted R2-D2 beanie hat for teens and adults.

$42.00Details

Star Wars Cupcake Stencils

Our set includes Star Wars logo, Darth Vader, Yoda and a Stormtrooper

$19.99Details


Victorinox Swiss Army Classic Pocket Knife

The Classic is the perfect pocket-size model, with seven functions, including tweezers and toothpick.

$17.50Details

Star Wars Lightsaber USB Glow Lamp

USB Light Saber Lamp

$31.00Details


Framed Star Wars YODA best quotes text print

This is a limited edition TEXT art piece. The image is made up entirely of colored text.

$19.99Details


Handmade Star Wars Chewbacca Stuffed Plush Animal

Carry Chewie where ever you go! 20 inches tall with cute button eyes and a cute button nose! Handmade out of the softest fluffiest brown fur availabel! Comes with bandolier.

$28.00Details


Uncle Milton Lightsaber Room Light

Construct your own Jedi lightsaber and mount your creation as a room light on the wall. Eight color effects let kids personalize their lightsaber, and a wireless remote control turns the light on and off.

$24.99Details


Kotobukiya Star Wars: Han Solo in Carbonite Silicon Tray

Freeze your own Han Solo! Here comes an innovative Star Wars kitchen product from a galaxy far, far away. This time around, the fun gets frosty with the Han Solo in Carbonite Silicone Tray.

$8.89Details

Boba Fett Star Wars Hat

Now you too can be digested by the Sarlac Pit Monster!

$49.99Details


Uncle Milton Star Wars Science Death Star Planetarium

This table top Death Star opens up into a planetary projector to display the cosmos on your bedroom ceiling.

$19.88Details

Star Wars Bath Playset

Includes R2D2, C3PO, Yoda, Darth Vader, Boba Fett, Stormtrooper, and Chewbacca

$35.99Details


Star Wars Ultimate Darth Vader FX Lightsaber

Act just like Darth Vader with the Darth Vader Star Wars Ultimate FX Lightsaber, a glowing, humming, clashing Lightsaber that looks and feels just like the real thing.

$38.99Details

Star Wars - Movie Poster (Darth Vader: Your Empire Needs You) (Size: 24" x 36")

Star Wars Movie Your Empire Needs You Darth Vader Poster Print - 24x36

$7.99Details



Underground Toys Star Wars 9" Talking Plush - Chewbacca

This Classic talking Star Wars recreation of absolutely everyone's favorite Wookie, is incredibly cute and life like!

$25.08Details

Star Wars Deluxe Set of 6 Movie Posters From ALL the Star Wars Movies

6 STAR WARS MOVIE POSTERS on Quality Stock Paper One full size movie poster from each Star Wars Episode.

$32.99Details


Underground Toys Star Wars 9" Talking Plush - R2-D2

Why not take a load off and cuddle up with this wonderful, talking, soft plushes while war rages on between the Empire and the Rebel forces!

$22.34Details


Star Wars Darth Vader Helmet

Are you ready to feel like the villain to end all villains This detailed DARTH VADER electronic helmet will make the action feel incredibly real!

$19.97Details

Star Wars "Men of Distinction" set of two 11x17 prints (Darth Vader & Boba Fett), unframed

Have you ever wished for Star Wars-related art with class and distinction? Look no further; this dark lord and bounty hunter duo knows how to settle things like true gentlemen.

$20.00Details


Star Wars 10 oz Glasses, Set of 4

1 each of Princess Leia, Darth Vader, Luke Skywalker, and Han Salo

$25.00Details


Vandor 18-Ounce Ceramic Mug, Star Wars Yoda

You don't need to travel to a galaxy far, far away to find your favorite classic Star Wars characters.

$19.26Details



Custom HAND Painted Heels - Star Wars

THE VERY BEST CUSTOM STAR WARS HEELS YOU WILL FIND!

$275.00Details

Bling Jewelry Sterling Silver Elongated Teardrop Bangle Bracelet

This bracelet is great for every day wear and elegant for dressy affairs.

$49.99Details


Revell Star Wars -Millennium Falcon

Perhaps the most iconic starship in the universe.

$35.61Details

Drinkwell Platinum Pet Fountain

Pet water fountain.

$44.06Details


Stainless Steel Aqua Resin Dome Ring

Beautiful Stainless Steel Aqua Resin Dome Ring

$31.99Details

LEGO Kids' 9002113 Star Wars Darth Vader Mini-Figure Alarm Clock

This LEGO Darth Vader clock is a must-have addition to the night table, dorm room or executive desk of any Star Wars fan.

$29.99Details


Fogless Shower Mirror with Squeegee by ToiletTree Products. Guaranteed Not to Fog, Designed Not to Fall.

Look your best by taking care of your face in your shower. This patent pending mirror is guaranteed not to fog in the shower.

$34.95Details


LEGO Kids' 9002137 Star Wars Storm Trooper Mini-Figure Alarm Clock

A superb character mini figure style clock from the masters at Lego, featuring Alarm and a Snooze Button!

$23.99Details

Magic Bullet MBR-1701 17-Piece Express Mixing Set

The magic bullet replaces a food processor, blender, and coffee grinder. Yet it occupies only the space of a coffee mug.

$38.49Details


Snap Circuits Jr. SC-100

Curious young minds can learn the basics of electronics as they build more than 100 exciting projects with this kit. Work on projects that make sound effects, engineer different types of alarms, build touch circuits and play games.

$18.00Details

Sweet Valley Confidential: Ten Years Later

Jessica and Elizabeth Wakefield are back and all grown up, dealing with the complicated adult world of love, careers, betrayal, and sisterhood.

$8.80Details


Star Wars: Episode I-VI - Movie Poster (All Characters - With Space Ships) (Size: 36 x 24) Poster Print, 34x22

Star Wars: Episode I-VI - Movie Poster (All Characters - With Space Ships) (Size: 36 x 24)

$2.82Details

Just Kids

Just Kids begins as a love story and ends as an elegy. It serves as a salute to New York City during the late sixties and seventies and to its rich and poor, its hustlers and hellions. A true fable, it is a portrait of two young artists' ascent, a p

$10.88Details


Vinturi Essential White Wine Aerator

Specially designed to aerate white wine and produce better bouquet, enhanced flavors and smoother finish

$42.89Details

The Feminine Mystique

This is the book that defined "the problem that has no name," that launched the Second Wave of the feminist movement.

$11.53Details


Star Wars Clone Wars Comforter - Twin

Star Wars Clone Wars Comforter.

$34.83Details

Pantone Universe Mug Violet 7672

The PANTONE UNIVERSE mugs by Whitbread Wilkinson are made with fine bone china.

$15.95Details


The Mountain Three Wolf Moon Short Sleeve Tee

This shirt needs no description.

$35.00Details

Wild Planet Lazer Tripwire

Warning alarms alert you to intruders, while 3 lazer units form a perimeter that protects your top secret stuff – just like banks and museums use!

$20.09Details


Star Wars: The Complete Saga (Episodes I-VI) [Blu-ray]

The Ultimate Sci-Fi Series on Blu-Ray.

$86.99Details

Modernist Cuisine: The Art and Science of Cooking

The ultimate cookbook. Mind-blowingly beautiful and fascinating cook book that goes into the science of cooking.

$450.07Details


This Is Why You're Fat: Where Dreams Become Heart Attacks

It was the birth of the nasty food web-trend. And it was delicious.

$9.99Details


Star Wars: The Complete Visual Dictionary - The Ultimate Guide to Characters and Creatures from the Entire Star Wars Saga

Provides a complete, comprehensive overview of the Prequel movies (Episodes I-III) and the Trilogy (Episodes IV-VI), this is the definitive photographic guide to the entire Star Wars saga.

$26.40Details

Hydrofarm HGTL Thirsty Light Original Digital Indoor Plant Moisture Sensor

When a plant's soil becomes dry, the LED on the Thirsty Light blinks to let you know.

$9.15Details


Captain Mal's Pistol from Firefly - Resin cast kit - Hand Painted

Offered here is a premade cast resin kit of Jayne's Custom Lemat "Boo" from Firefly and Serenity fame.

$249.99Details

Marini's Candies Chocolate Covered Bacon 1/2 lb. Gift Box

Hickory smoked bacon is cooked in the oven until golden & crisp then it's smothered in milk chocolate.

$12.95Details


Boba Grafetti baby tee

You should wait for the paint on your helmet to dry before launching head first into a sail barge, it may leave a nasty imprint of your defeat.

$18.95Details

Vera Bradley Knot Just a Clutch Bag in Bali Gold

A new Clutch to added to the collection. Has a beautiful knoted design on the front.

$39.00Details


Doctor Who 11 Doctors 5" Action Figure Collector Set

This boxed set features 5 inch figures of the eleven men to portray the Doctor in the BBC series, with new costumes and new sculpts.

$99.99Details


Evolution of Evil T-Shirt

There has been a disturbance in the force, and it ain't good.

$19.95Details

Vera Bradley Convertible Kisslock in Lemon Parfait

A wallet by day and a purse by night, this convertible accessory is fun, flirty and large enough to hold a Smartphone.

$27.95Details


(12x16) Serenity Movie Firefly Blueprints Reference Pack Spiral Bound Book

Blueprints in case you ever want to make your own Serenity

$42.93Details

Gerber 31-000751 Bear Grylls Survival Series Ultimate Knife, Serrated Edge

Intricately designed by Gerber and Bear, it's loaded with innovations that won't be found in any other fixed blade knife. Like everything in the Survival Series, it also includes Bear's Priorities of Survival pocket guide.

$42.13Details


Ackbarpography t-shirt

Take a closer look and you'll discover the holy grail of science fiction one-liners... IT'S A TRAP!

$19.95Details

Michael Kors Quartz, Mother of Pearl Dial with White Acrylic Link Band - Womens Watch MK5079

It has an eye-catching mother-of-pearl dial and bezel that are adorned with crystals that glisten like diamonds.

$140.63Details


River Tam and the Fireflies (Poster)

Join the crew of this firefly class transport ship as they aim to misbehave with hit songs such as "I Swallowed A Bug", "Nothin' Twixt My Nethers", and their new, hit single "Miranda".

$20.00Details

TOTO Washlet - Temperature Controlled Toilet Seat

Cold Toilets are so yesterday.

$409.86Details


Stormtroopa t-shirt

When someone always rescues the princess, when a short stumpy plumber can dismantle an entire evil empire, when all the giant bombs and bullets of the world just aren't enough - it's time to consider the benefits of mass-production!

$19.95Details

Envirosax Rosa RO.P Shoulder Bag,Multi,One Size

Envirosax shopping bags carry a message of sustainable living to a world ready to embrace a brighter ecological future.

$38.50Details


Firefly Poster TV 11x17 Nathan Fillion Morena Baccarin Adam Baldwin Ron Glass

Firefly Reproduction Poster Print Style A 11 x 17 Inches -28cm x 44cm

$19.99Details

Learning Resources Zoomy Handheld Digital Microscope

Amazing all-in-one digital microscope takes scientific inquiry to a new level - yet is easy for even a young child to use.

$59.95Details


Peek into the Dark Side t-shirt

What would you do with the power? We feel a breeze in the Force.

$19.95Details

PostSecret: Extraordinary Confessions from Ordinary Lives

A global phenomenon, exposing our individual aspirations, fantasies, and frailties -- our common humanity.

$17.68Details


Map of the Verse (Rolled)

Map of the Verse (Poster)

$41.50Details

Something to Read on the Plane

A delightfully light-hearted variety of stories, articles, limericks, and even a quiz to see how good a passenger you are.

$0.99Details


Sci Fi Reference t-shirt

This is our remastered Sci-Fi movies reference t-shirt.

$19.95Details

Lilly Pulitzer iPad & Netbook Sleeve - Nice To See You

Protect your iPad/NetBook in style.

$29.95Details


DiY Serenity Firefly Small Tote Bag Malcolm Reynolds

This is a brand new lightweight small purple tote bag.

$12.00Details

Swiss+Tech UKCSB-1 Utili-Key 6-in-1 KeyChain MultiTool

The lightest and most compact multi-use tool ever developed.

$7.50Details


Star Wars: The Clone Wars - The Complete Season One

This new TV series takes place immediately after the events of Star Wars-Episode II: Attack of the Clones.

$44.98Details

Cuponk Boomshakalaka

Sink your ball into the cup and light it up. Get it in and you'll hear the sweet sounds of victory.

$19.77Details


(24x36) Serenity Movie (Firefly Group) Poster Print

(24x36) Serenity Movie (Firefly Group) Poster Print

$9.80Details

Fanboys

Get ready for the comedy adventure that's "smart, funny, and tailor-made for the inner-Jedi in all of us"

$6.49Details


1888 Mills Luxury Cotton Made in Africa Bath Towel, White

Super soft bath towel from African cotton with sales contributing to reducing poverty in Africa.

$16.03Details

Firefly Poster TV D 11x17 Nathan Fillion Morena Baccarin Adam Baldwin Ron Glass

Firefly reproduction Approx. Size: 11 x 17 Inches - 28cm x 44cm Style D mini poster print

$24.99Details


Michael Kors Perfume for Women 1 oz Eau De Parfum Spray

Creamy florals explode into exotic spices, tamed by Moroccan incense. A fragrant creation with a wealth of personality that will capture the heart of every woman.

$69.99Details

Star Wars: The Old Republic

Star Wars: The Old Republic is a Massively Multiplayer Online Role-playing Game

$59.95Details


Sense and Sensibility

Jane Austen's most famous novel. It's about the necessity of finding a workable middle ground between passion and reason.

$9.99Details

Firefly Serenity 36 Inch Full Afterburner Fiberglass Model Built, Finished, Painted, and Lighted

Full Afterburner 36 inch fiberglass Firefly model ready for display.

$599.00Details


Flowerbomb by Viktor & Rolf for Women - 3.4 Ounce EDP Spray

Launched by the design house of Viktor & Rolf.

$109.14Details

Kinect Star Wars

Feel the Force as you transform yourself into a Jedi. Fully harnesses the power of the Kinect platform to deliver a natural and intuitive Star Wars experience.

$49.96Details


Anna Karenina

There is no doubt that Anna Karenina, generally considered Tolstoy's best book, is definitely one ripping great read.

$24.99Details


Trish Mcevoy No. 9 Blackberry & Vanilla Musk

TRISH MCEVOY NO. 9 BLACKBERRY & VANILLA MUSK by Trish McEvoy

$48.00Details

Lego Star Wars: The Complete Saga

Play through the events of all 6 Star Wars movies in 1 videogame for the first time ever.

$17.29Details


Madame Bovary

A story of a woman trapped in a loveless marriage in 19th century France.

$18.49Details

Joss Whedon's Firefly Serenity 11x17 Original Promotional Movie Poster

Promotional Serenity Movie poster. These were given to theaters and also sci fi convention promotors to hand out to fans. Along with everything Serenity, they have become highly collectible.

$9.95Details


Flawless Sterling Silver Floating Heart, 13/16" X 13/16"

Beautiful Floating heart. Solid Sterling Silver, Excellent mirror like finish.

$79.95Details

RoomMates RMK1382SCS Star Wars: The Clone Wars Glow in the Dark Wall Decals

All the light sabers glow in the dark, need I say more?

$9.97Details


The Portrait of a Lady (Penguin Classics)

A story of intense poignancy, Isabel's tale of love and betrayal still resonates with modern audiences.

$12.00Details

Serenity Atlas of the Verse, Volume 1

The Atlas of The Verse is loaded with beautiful art, incredible renderings and detailed diagrams that really help bring The Verse to life.

$42.42Details


Satya Jewelry Silver Turquoise, Hamsa, Lotus Charm Necklace

Turquoise, the stone of healing, and the Hamsa which protects against negative energies, meet the lotus as a symbol of renewal and transformation.

$98.00Details

Operation Star Wars Edition

R2D is on the blink and looking for a steady hand to help. Can you repair a cranky crankshaft or a hiccupping hologram?

$26.93Details


Mrs. Dalloway / A Room of One's Own

One of Virginia Woolf's greatest novels paired with an influential essay on the role of women in society.

$14.81Details


Bling Jewelry Sterling Silver Turquoise Five-strand Bracelet [Jewelry]

Five strands of hand-strung turquoise nuggets are attached to a .925 sterling silver bar clasp.

$39.99Details

Meon Star Wars - Interactive Animation Studio

Make your own Star Wars animated signs that light up like Neon.

$11.99Details


Orlando (Wordsworth Classics)

Virginia Woolf's Orlando 'The longest and most charming love letter in literature', playfully constructs the figure of Orlando as the fictional embodiment of Woolf's close friend and lover, Vita Sackville-West.

$4.99Details

Audio-Technica ATH-M50 Professional Studio Monitor Headphones

One of the most popular headphone sets in existence. Designed for DJs/Producers, they are fantastic for anyone.

$159.00Details


Sony ICFS79W AM/FM/Weather Band Digital Tuner Shower Radio (White)

Listen to your favorite shows while you shower.

$52.58Details


Firefly Fruity Oaty Bar Not Mandatory T-shirt XL

This cool Serenity t-shirt features the Fruity Oaty Bar ad in a high quality, vintage look print.

$22.95Details



Firefly Light Tile Pendant FF4

Firefly Light Scrabble Tile Pendant (Pendant Only)

$8.00Details

Presto Pro EverSharp Electric Knife Sharpener

Razor sharp knives whenever you want - easy, automatic. Professional two-stage system sharpens in seconds. Blade guides automatically hold knife at ideal sharpening angle.

$27.00Details


Firefly: Still Flying: A Celebration of Joss Whedon's Acclaimed TV Series

Still Flying is a brand new celebration of all aspects of the show, featuring a wealth of rare and previously unpublished images including storyboards, production design art and candid behind the scenes photos, memories from the cast

$13.57Details

Joss Whedon's Serenity Ornament Inara's Shuttle

Fans of Firefly will be familiar with the shuttle that Inara Serra, well-respected companion, rents from Serenity for her periods of separation from the ragtag crew.

$19.95Details


Thermos Stainless King SK1005MB4 16-Ounce Leak-Proof Travel Mug, Midnight Blue

The ultra-durable, leak-proof Thermos Stainless King travel mug features an unbreakable stainless steel interior and exterior, making it a great companion for use in rough-and-tumble situations such as construction sites, delivery work, and more.

$19.43Details

Serenity - Firefly Metal Keychain

Serenity is about freedom. Serenity is about going where you want, when you want, with nothing in The Verse to stop you.

$22.98Details


Firefly Inspired - Leaf on the Wind, Watch How I Soar Necklace

'I am a leaf on the wind. Watch how I soar.' Only a Firefly fan would appreciate the tragic beauty of Wash's last line.

$17.95Details

Carhartt Women's Sandstone Sierra Jacket/Sherpa-Lined,Black,Medium

Our sandstone sierra jacket is sherpa-lined for added warmth. It's made of 12-ounce, 100% cotton sandstone duck and features princess back seams for a premium fit, built-in bi-swing for ease of movement, interior rib-knit storm cuffs, two inside poc

$89.68Details


Serenity PVC Set

You get Mal, River, and Jayne in this set of PVC figures based on Joss Whedon's blockbuster film Serenity.

$19.99Details

Firefly - The Complete Series

One of the greatest shows to ever be cancelled.

$24.99Details



Serenity (Widescreen Edition)

The Firefly Movie. Picks up where Firefly left off, but doesn't alienate people who have never seen the TV show.

$9.99Details


Bronze Firefly Wash quote bracelet

Firefly Fans and Family. I have made a bronze and leather appx 1 inch cuff with the I am a leaf on the wind leather name plate.

$35.00Details

Done The Impossible: The Fans' Tale of Firefly & Serenity

Adam Baldwin hosts the telling of this vivid Browncoat story that features interviews with Joss Whedon, creator of Firefly and Serenity, the cast, crew, and most important, the fans themselves.

$12.95Details


Quantum Mechanix Serenity: Big Damn Heroes: River Tam Maquette

Serenity's psychotic killing machine River Tam

$49.98Details

Firefly/Serenity Jayne Hat

This awesomely cunning hat, in the style of our favorite PR specialist from Firefly - Jayne Cobb, is made of SUPER soft acrylic in colors that perfectly match the original from the show!

$35.00Details


Firefly Inspired Tshirt - Also, I Can Kill You with My Brain

A fantastic printed t-shirt inspired by the Firefly and Serenity. (Price GBP)

$9.99Details

Serenity Define Interesting T-Shirt

Define Interesting. 1. Capable of holding one's attention. 2. Arousing a feeling of interest. 3. Oh God, oh God, we're all going to die.

$21.88Details


Firefly (Original Television Soundtrack)

Composer Greg Edmonson created a flavorful, guitar-based score for the adventures of the crew of Serenity. CD features exclusive bonus tracks.

$14.99Details


Serenity

This action/adventure/Sci-Fi/western features an eclectic score by composer David Newman.

$17.04Details


Firefly Necklace- You can't take the sky from me

Can't take the sky from me necklace

$25.00Details

Serenity Firefly Crime To Be Done Mal T-shirt

Got us some crime to be done.

$17.95Details


Sterling Silver Peridot, Garnet, Amethyst, Blue Topaz and Citrine Individually Boxed Stud Earring Set

Add sparkle and variety to your wardrobe with this set of five individually boxed sterling silver stud earrings, showcasing five different colored gemstones.

$41.99Details

Firefly Logo T-Shirt

We like Firefly. You like Firefly. This here's a Firefly all official-like t-shirt.

$17.99Details


Cards Against Humanity

Cards Against Humanity is a party game for horrible people. Unlike most of the party games you've played before, Cards Against Humanity is as despicable and awkward as you and your friends.

$25.00Details


Swedish Firesteel - Army Model, Black Handle

Originally developed for the Swedish Department of Defense, Swedish FireSteel is a flash of genius. Its 3,000°C spark makes fire building easy in any weather, at any altitude.

$15.05Details

Camelbak M.U.L.E. 100 oz Hydration Pack, Chili Pepper/Charcoal

The M.U.L.E. NV from Camelbak is a narrow-gauge pack for 3+ hours of all-terrain adventures in any weather.

$69.98Details


Flash Cooking System Sapphire Blue 000 by JETBOIL

Designed to capture and focus heat more efficiently than traditional cooking systems, the Flash brings two cups of water to a boil in only two minutes.

$80.71Details

Star Wars X Wing Pilot Hoodie

This Star Wars X-Wing Pilot Hoodie is specifically customized to reflect Luke Skywalker's jumpsuit, visor and specific helmet designs.

$150.00Details


Sea To Summit Ultra-Sil Daypack

Backpack that fits on a keychain.

$26.96Details

Levitron AG Anti-Gravity Globe

Observe Earth levitate in space - only touching air!

$79.99Details


Think Geek Star Trek Enterprise Pizza Cutter

Boldly go where no pizza has gone before with Think Geek's Star Trek Pizza Cutter.

$24.99Details

Halo 3, Master Chief Costume, Adult Standard

Quilted jumpsuit with EVA armor, two-piece deluxe helmet, gauntlets and boot tops.

$580.46Details


Aperture Science Mug

Welcome to Aperture Laboratories, A Trusted Friend in Science!

$12.99Details

Sphere Pen Camera - Hidden Video Spy Pen

1.5 hours of high quality video stored on 4GB memory card.

$99.99Details


Infrared Mini Radio Controlled Marine Cobra Helicopter Gyro

Mini remote control helicopter. USB charger.

$24.94Details

Fred and Friends OCD Cutting Board

Cut everything to perfection.

$25.00Details


Pillow Remote Control

Never again will you have to ask, "wheres the remote" And youll never lose this remote in between the cushions. Because it IS a cushion.

$39.99Details


Wild Planet Lazer Tripwire

Warning alarms alert you to intruders, while 3 lazer units form a perimeter that protects your top secret stuff just like banks and museums use!

$19.92Details

Pet Umbrella (Dog Umbrella) Keeps your Pet Dry and Comfotable in Rain

Keep your pet happy and dry in rain, sleet or snow!

$14.95Details


Sea to Summit Pocket Shower

Bring an 8 minute shower anywhere you go. Also works as a regular dry sack.

$24.21Details

Sport-Brella Umbrella Chair, Blue

Tired of all the shady spots being taken? Bring your own chair and shade together!

$39.99Details


Cat Attack Scratching Post

Run for your lives! Catzilla is tearing up the city once again thanks to the Cat Attack Scratching Post!

$29.99Details

Glow Graffiti Toolset - Paint with Light

It's the dead of night; everyone is tucked up in bed and the owls are-a-hooting. So it's time to break out the Glow Graffiti!

$34.99Details


Kurt S. Adler 10-Light Star Wars R2D2 Light Set

This novelty light set features 10 R2D2 lights with 30-inch lead wire and 12-inch spacing.

$30.00Details

Star Wars Chewbacca Back Buddy Plush

Now Chewy can join you everywhere you go.

$45.00Details


Clocky Alarm Clock on Wheels, Almond

This alarm clock runs away from you to make sure you get out of bed.

$49.99Details

Emile Henry Flame Top Pizza Stone, Black

Create marvelous pizzas at home.

$50.00Details


Fred & Friends Beat It Chopsticks Set

One end of each chopstick is a regualr chopstick shape while the other end of of the chopstick is in the shape of a drumstick.

$14.99Details

Star Wars Storm Trooper USB Drive 4GB

Storm Trooper USB stick.

$34.99Details


Suck UK Skate Mirror

The Skate Mirror is made from stainless steel and mirrored glass, as well as genuine skate trucks.

$200.00Details

Smart Planet CDM-1 Corn Dog Maker

Make your very own corn dogs

$24.99Details


© Gift Lizard 2011