×

Find gifts by describing the person you are trying to buy for. Use things like who they are (dad), their hobbies (star wars), their personality (geek, gamer).

You searched for: geekstar warstravelkidskitchengamescampingbooksdrinkingbathroomlovediablomuggirlfriend

Reset Tags. (Click a tag to remove it. Add tags on the left side.)

The Hungover Cookbook

Learn to cure your hangover with these delicious recipes!

$10.00Details

Madame Bovary

A story of a woman trapped in a loveless marriage in 19th century France.

$18.49Details


The Portrait of a Lady (Penguin Classics)

A story of intense poignancy, Isabel's tale of love and betrayal still resonates with modern audiences.

$12.00Details

Sense and Sensibility

Jane Austen's most famous novel. It's about the necessity of finding a workable middle ground between passion and reason.

$9.99Details


Anna Karenina

There is no doubt that Anna Karenina, generally considered Tolstoy's best book, is definitely one ripping great read.

$24.99Details

LEGO Star Wars Ultimate Collector's Millennium Falcon

Han Solo's famous starship is crafted from over 5,000 Lego pieces.

$499.99Details


Flawless Sterling Silver Floating Heart, 13/16" X 13/16"

Beautiful Floating heart. Solid Sterling Silver, Excellent mirror like finish.

$79.95Details

Kurt S. Adler 10-Light Star Wars R2D2 Light Set

This novelty light set features 10 R2D2 lights with 30-inch lead wire and 12-inch spacing.

$30.00Details


Kindle Fire, Full Color 7" Multi-touch Display, Wi-Fi

Kindle Fire isn't just for books anymore. Web, Apps, Video, Magazines, Music and More!

$199.00Details

Sea To Summit Ultra-Sil Daypack

Backpack that fits on a keychain.

$26.96Details


Radica 20Q Artificial Intelligence Game - Colors may vary since the item may come in 3 different colors

I didn't believe it would work, but I tested the online version and it got 'Satellite' correct. Impressed.

$19.99Details


Star Wars Interactive R2D2

Dancing to Cantina Music, bringing you drinks and guarding your precious stuff. What more could you ask for from the most faithful robot in the galaxy?

$199.99Details

Jedi Dressing Gowns - Star Wars Bath Robes

Those aren't the droids you're looking for.

$88.44Details


Operation Star Wars Edition

R2D is on the blink and looking for a steady hand to help. Can you repair a cranky crankshaft or a hiccupping hologram?

$26.93Details

LEGO Kids' 9002137 Star Wars Storm Trooper Mini-Figure Alarm Clock

A superb character mini figure style clock from the masters at Lego, featuring Alarm and a Snooze Button!

$23.99Details


Adagio Teas 16-Ounce Ingenuitea Teapot

Great for the office or when traveling, this innovative teapot releases infused tea into a drinking cup. When tea is ready, simply place it atop the cup, causing a valve at the bottom to release and crystal-clear tea to flow down.

$17.45Details


Pleo Dinosaur - A UGOBE Life Form

Pleo looks, moves, sounds and behaves like a living creature. Fully aware and cognitive, he explores his environment and interacts with people, accessories and other UGOBE dinosaurs.

$508.08Details

Mindflex Duel Game

Mindflex Duel is the ultimate head-to-head brain game challenge

$74.99Details


Bananagrams

The Anagram game that will drive you bananas. The award-winning word game that needs no pencil, paper, or board. Fast and fun.

$14.95Details

Zen Magnets - Gift and Retail Packed Zen Set

Zen Magnets. These super powerful and tiny magnets are a lot of fun for kids and adults.

$59.95Details


Sport-Brella Umbrella Chair, Blue

Tired of all the shady spots being taken? Bring your own chair and shade together!

$39.99Details

SHOT GLASS ICE MOLD (13PC. SET)

Take the chill off your next soiree when you serve guests a shot in an edible frozen glass.

$14.99Details


Kikkerland Skull Shot Glasses, Set of 4

Skull Shot Glasses, do I really need to write more than that?

$11.99Details

Star Wars Storm Trooper USB Drive 4GB

Storm Trooper USB stick.

$34.99Details


12 Gauge Shot Glass

Fire off a few rounds with our set of 12 Gauge Shot Glasses.

$17.95Details


Das Boot

Das Boot.

$34.99Details

Cake Pop & Donut Hole Bakery

Make your own donut holes at home!

$24.99Details


Tailgate Folding Wooden Picnic Table

Have a picnic anywhere with the comfort of your own personal picnic table.

$134.99Details

Pool Table, Tabletop

Mini pool table.

$39.95Details


Think Geek Star Trek Enterprise Pizza Cutter

Boldly go where no pizza has gone before with Think Geek's Star Trek Pizza Cutter.

$24.99Details

Fred Cool Jazz Ice Cube Tray

It is time to kick back and chill and here is a cool way to do it! Drop one of these groovy guitars into your drink, and give it a stir. Just the thing for jazzing up your favorite beverage.

$7.99Details


True Fabrications Chain Bottle Rack

Use the magic chain to proudly show your wine anywhere. Simply put a bottle through the loop and let the chrome plated steel chain do the rest.

$24.95Details

Multi Green Laser 5mw

As seen on ghost hunters. You know it is legit now!

$11.75Details


Obol, the Never-Soggy Cereal Bowl

Soggy cereal is a problem of the past.

$19.99Details

Infrared Mini Radio Controlled Marine Cobra Helicopter Gyro

Mini remote control helicopter. USB charger.

$24.94Details


Sea to Summit Pocket Shower

Bring an 8 minute shower anywhere you go. Also works as a regular dry sack.

$24.21Details


Mrs. Dalloway / A Room of One's Own

One of Virginia Woolf's greatest novels paired with an influential essay on the role of women in society.

$14.81Details

Orlando (Wordsworth Classics)

Virginia Woolf's Orlando 'The longest and most charming love letter in literature', playfully constructs the figure of Orlando as the fictional embodiment of Woolf's close friend and lover, Vita Sackville-West.

$4.99Details



Atonement: A Novel

Ian McEwan s symphonic novel of love and war, childhood and class, guilt and forgiveness provides all the satisfaction of a brilliant narrative and the provocation we have come to expect from this master of English prose.

$10.20Details

The Brief Wondrous Life of Oscar Wao

Oscar is a sweet but disastrously overweight ghetto nerd who's from the New Jersey home he shares with his old world mother and rebellious sister's dreams of becoming the Dominican J.R.R. Tolkien and, most of all, finding love.

$10.20Details


Kate Spade iPhone 4 Tropical

This fun striped pattern is done in bold shades of lavender, yellow-gold,blue, fuschia, pink and lime.

$25.00Details

PostSecret: Extraordinary Confessions from Ordinary Lives

A global phenomenon, exposing our individual aspirations, fantasies, and frailties -- our common humanity.

$17.68Details


Letters to a Young Poet

Those looking for an alluring image of the solitary artist--and for an astonishing quotient of wisdom--will find both in Letters to a Young Poet.

$4.99Details

Cuponk Boomshakalaka

Sink your ball into the cup and light it up. Get it in and you'll hear the sweet sounds of victory.

$19.77Details


1888 Mills Luxury Cotton Made in Africa Bath Towel, White

Super soft bath towel from African cotton with sales contributing to reducing poverty in Africa.

$16.03Details

Just Kids

Just Kids begins as a love story and ends as an elegy. It serves as a salute to New York City during the late sixties and seventies and to its rich and poor, its hustlers and hellions. A true fable, it is a portrait of two young artists' ascent, a p

$10.88Details


Roulette Shot Glass Bar Drinking Game Set

The party starts when the ball stops rolling!

$29.99Details

Tea Sub - Yellow Submarine Tea Infuser

We all live in a yellow submarine, a yellow submarine,a yellow subm...

$10.81Details


Men's Play Money Tie by Fun Ties in Black

This unique novelty tie features colorful play money on a durable black polyester fabric. This necktie is worth a million dollars, well a million dollars in play money.

$25.00Details

Shower Shock Caffeinated Soap

the original and world's first caffeinated soap from ThinkGeek. When you think about it, ShowerShock is the ultimate clean buzz ;)

$6.99Details


Lush Life Party Ice Luge

Let the fun begin when your pour your favorite drink down the luge.

$22.50Details

Star Wars Chewbacca Back Buddy Plush

Now Chewy can join you everywhere you go.

$45.00Details


Fred & Friends Beat It Chopsticks Set

One end of each chopstick is a regualr chopstick shape while the other end of of the chopstick is in the shape of a drumstick.

$14.99Details

Reamde: A Novel

Reamde is a swift-paced thriller that traverses worlds virtual and real. Filled with unexpected twists and turns in which unforgettable villains and unlikely heroes.

$18.99Details


IMCG Fridge Monkey - Charcoal

Bottles, Cans and drinks in general shouldn't fall out of the fridge ever again.

$7.99Details

Levitron AG Anti-Gravity Globe

Observe Earth levitate in space - only touching air!

$79.99Details


Sweet Valley Confidential: Ten Years Later

Jessica and Elizabeth Wakefield are back and all grown up, dealing with the complicated adult world of love, careers, betrayal, and sisterhood.

$8.80Details

Aperture Science Mug

Welcome to Aperture Laboratories, A Trusted Friend in Science!

$12.99Details


Uncle Milton Lightsaber Room Light

Construct your own Jedi lightsaber and mount your creation as a room light on the wall. Eight color effects let kids personalize their lightsaber, and a wireless remote control turns the light on and off.

$24.99Details

Uncle Milton Star Wars Science Death Star Planetarium

This table top Death Star opens up into a planetary projector to display the cosmos on your bedroom ceiling.

$19.88Details


Camelbak M.U.L.E. 100 oz Hydration Pack, Chili Pepper/Charcoal

The M.U.L.E. NV from Camelbak is a narrow-gauge pack for 3+ hours of all-terrain adventures in any weather.

$69.98Details

Star Wars Science - Force Trainer

May the Force be with you! The Force Trainer by Uncle Milton actually allows you to control a Jedi Training Remote with your mind, by tapping into cutting-edge brainwave technology.

$35.95Details


About Face 3: The Essentials of Interaction Design

This completely updated volume presents the effective and practical tools you need to design great desktop applications, Web 2.0 sites, and mobile devices. This book will teach you the principles of good product behavior.

$45.00Details

Don't Make Me Think: A Common Sense Approach to Web Usability, 2nd Edition

100,000 copies sold. If you do anything web related, this book is a must read.

$40.00Details


The Design of Everyday Things

Anyone who designs anything to be used by humans--from physical objects to computer programs to conceptual tools--must read this book, and it is an equally tremendous read for anyone who has to use anything created by another human.

$15.95Details

Air Swimmer Remote Control Inflatable Flying Shark

Flying Sharks. Who wouldn't want one?

$39.99Details


Men's Tetris Tie by Game Tie in Black

The classics of menswear and video games have finally come together to bring you this remarkable men's Tetris necktie.

$35.00Details

All My Friends Are Dead

All My Friends Are Dead presents a delightful primer for laughing at the inevitable.

$9.95Details


Bath Tissue Tyrant: Commode Dragon

Some dragons are helpful. Rest peacefully knowing this dragon is guarding the most important thing in the room.

$34.95Details

Nintendo Wall Graphics - Super Mario Bros

Level up your room with this Mario Themed wall graphics.

$74.95Details


Super Mario Time to Team Up 50-by-60-Inch Microraschel Throw Blanket

Mario and Luigi race to save the game surrounded by icons and characters from your favorite video game. Cuddle up in this warm throw for a long day of video game fun.

$29.99Details

Fred and Friends Hopside Down Glass

Hopside Down, is that pun not enough of a description?

$20.00Details


Wookiee Cookies: A Star Wars Cookbook

Tusken Raider Taters, Yoda Soda, C-3PO Pancakes... mmmm sounds delicious!

$18.99Details

Harvil Tabletop Air Hockey Table

The Harvil Tabletop Air Hockey Table is a lightweight and affordable way to introduce the fun of air hockey to children.

$149.44Details


Kymera Magic Wand Remote Control

Imagine walking into the room with your children and their Muggle friends watching TV, whipping out a magic wand from under your jacket and changing the channel in a flash.

$89.99Details

Tasting Beer: An Insider's Guide to the World's Greatest Drink

Everything you ever wanted to know about beer!

$16.95Details


LEGO Kids' 9002113 Star Wars Darth Vader Mini-Figure Alarm Clock

This LEGO Darth Vader clock is a must-have addition to the night table, dorm room or executive desk of any Star Wars fan.

$29.99Details

Star Wars Bath Playset

Includes R2D2, C3PO, Yoda, Darth Vader, Boba Fett, Stormtrooper, and Chewbacca

$35.99Details


Sci Fi Reference t-shirt

This is our remastered Sci-Fi movies reference t-shirt.

$19.95Details

Bodum Brazil 8 cup French Press Coffee Maker, 34 oz, Black

Bodum Brazil offers a classic take on modern, functional design that will never go out of style.

$16.99Details


Wii Classic Controller Pro - Black

Created for accessibility and comfort, the Classic Controller Pro blends design elements from game systems such as the NES, Super NES, and Nintendo 64 providing seamless play control for a wide range of games.

$19.99Details

Pantone Universe Mug Violet 7672

The PANTONE UNIVERSE mugs by Whitbread Wilkinson are made with fine bone china.

$15.95Details


Sea Kelp / Moss with Chamomile Herb and Cocoa Butter Soap

The seaside scent in this natural beauty facial and body soap coupled with the invigorating hint of cocoa butter will make you feel like you are relaxing by the ocean.

$9.50Details

Star Wars: The Complete Saga (Episodes I-VI) [Blu-ray]

The Ultimate Sci-Fi Series on Blu-Ray.

$86.99Details


Sony ICFS79W AM/FM/Weather Band Digital Tuner Shower Radio (White)

Listen to your favorite shows while you shower.

$52.58Details

Gerber 31-000751 Bear Grylls Survival Series Ultimate Knife, Serrated Edge

Intricately designed by Gerber and Bear, it's loaded with innovations that won't be found in any other fixed blade knife. Like everything in the Survival Series, it also includes Bear's Priorities of Survival pocket guide.

$42.13Details


Fasta Pasta The Microwave Cooker

No waiting for a big pot of water to boil. Cook pasta to al dente perfection in the microwave! Saves time, energy and water.

$8.99Details

MIU France Zinc Alloy Connoisseur Corkscrew Wine Opener

The next best thing to an in-house sommelier, this professional-quality wine opener offers the same impressive performance and stylish design as corkscrews that cost far more.

$20.99Details


iHome iHM60LT Rechargeable Mini Speaker (Blue Translucent)

The iHM60 is an amazing approach to audio that offers size defying sound. Speaker connects to a computer or other USB power source via the included USB cable to recharge the internal lithium ion battery.

$19.99Details


Learning Resources Zoomy Handheld Digital Microscope

Amazing all-in-one digital microscope takes scientific inquiry to a new level - yet is easy for even a young child to use.

$59.95Details

Thermos Stainless King SK1005MB4 16-Ounce Leak-Proof Travel Mug, Midnight Blue

The ultra-durable, leak-proof Thermos Stainless King travel mug features an unbreakable stainless steel interior and exterior, making it a great companion for use in rough-and-tumble situations such as construction sites, delivery work, and more.

$19.43Details


Vinturi Essential White Wine Aerator

Specially designed to aerate white wine and produce better bouquet, enhanced flavors and smoother finish

$42.89Details

PUR 18 Cup Dispenser with One Pitcher Filter DS-1800Z

Keep your water clear of chemicals and odors with this dispenser from PUR. Its advanced filtration system reduces more contaminants (lead, copper, zinc, etc.) than any other pour-through filter.

$27.81Details


Swiss+Tech UKCSB-1 Utili-Key 6-in-1 KeyChain MultiTool

The lightest and most compact multi-use tool ever developed.

$7.50Details

Numi Organic Tea Flowering Gift Set in Handcrafted Mahogany Bamboo Chest: Glass Teapot & 6 Flowering Tea Blossoms

Packaged in an exotic hand-made dark mahogany bamboo case, this Flowering Gift Set is filled with six bouquets of tea leaves that blossom into a myriad of flavors from sweet and subtle to rich and bold.

$21.75Details


Handcrafted Figured Mahogany Case for iPhone 4/4S

Protect your phone with classic style.

$69.95Details

Fred and Friends PIBOSS Pizza Boss Pizza Wheel

Sick of cutting pizza with a knife? Tired of cutting yourself with a pizza cutter?

$15.00Details


Emile Henry Flame Top Pizza Stone, Black

Create marvelous pizzas at home.

$50.00Details

Garden Zombie

There's A Zombie On Your Lawn! Nobody was quite sure what caused it. An alien pathogen riding the tail of Halley's Comet? Some government "rage" virus? Radiation from a downed satellite?

$89.99Details


Norpro Nonstick Cake-Sicle Pan with 24 Sticks

I wish I had thought of this. Cakesicles. mmmm.... delicious

$19.99Details

Lumisource NESSIE Table Desk Lamp

Inspired by Nessie the Lochness Monster, this light keeps your kids company and is fun to play with.

$45.00Details


Suck UK Skate Mirror

The Skate Mirror is made from stainless steel and mirrored glass, as well as genuine skate trucks.

$200.00Details

Smart Planet CDM-1 Corn Dog Maker

Make your very own corn dogs

$24.99Details


Adjust-A-Cup 2-Cup Measuring Cup

Tired of having to deal with tons of different measurement cups and spoons? This elegant adjustable measuring cup solves everything.

$12.99Details

Silver Robot 8GB Flash Drive

When it comes to file storage, you want something as reliable as your favorite lovable robot.

$44.99Details


MATH CLASS Wall Clock mathematics teacher classroom gift

I probably will never know what time it is again.

$22.99Details

Mr. Beer Premium Gold Edition Home Brew Kit

A great starting point for a beginning and intermediate brewers, it includes two of Mr. Beer's most popular beer mixes as well as everything needed to both brew and bottle your first 2 batches of top-quality beer.

$59.99Details


MollaSpace Cottage Incense Pot

A cement made cottage incense house. Watch the scented smoke coming out of the chimney and indulge yourself in the creativity.

$66.00Details

World's Largest Giant Gummy Bear Cherry

Sometimes I just crave a gummy bear steak.

$29.15Details


The Slanket Blanket-Moss Green

A blanket that doesn't make you feel trapped.

$49.95Details

Exhaust Powered Car Jack

Jack your car up with the exhaust it's generating, simple and elegant car repair.

$224.98Details


Iron Man Mark II 12 Inch Deluxe Figure

This is a must for any collector Iron Man in this full body titanium color suit just like thr prototype in the movie.

$999.99Details

Syringe Ballpoint Pen

Inject some fun into your writing with this cool pen. It looks just like a syringe, and the pen extends every time you "make an injection."

$1.59Details


Handtrux Backhoe

HandTrux - when you're ready to play dirty! This amazing handroaulic power grip is a fun backhoe for dirt or sand. Just insert you hand in the sleeve, grab the lever inside the bucket and start digging!

$17.99Details

MANGROOMER Do-It-Yourself Electric Back Hair Shaver

The Mangroomer Do-It-Yourself Electric Back Shaver is absolutely the best way to get rid of unwanted back hair.

$39.99Details


Boon Glo Nightlight with Portable Balls, White

Boon Glo nightlight. Portable, don't heat up, turn off after 30 minutes and 95% effective at keeping monsters away all night long.

$84.99Details

Fred and Friends OCD Cutting Board

Cut everything to perfection.

$25.00Details


This is Spinal Tap (Special Edition)

You're about to get personal with one of music history's greatest and loudest heavy metal bands, Spinal Tap! Whether or not you're a die-hard fan of the group, you'll love this detailed "rockumentary" of Engand's legend

$7.49Details

Spirited Away

SPIRITED AWAY is a wondrous fantasy about a young girl, Chihiro, trapped in a strange new world of spirits. When her parents undergo a mysterious transformation, she must call upon the courage she never knew she had to free herself and return her family

$23.49Details


A Very She & Him Christmas

She & Him have set out to create an intimate holiday recording of Christmas classics that helps bring new emotions out of old songs.

$9.99Details

Extremely Loud and Incredibly Close MTI: A Novel

Nine-year-old Oskar Schell has embarked on an urgent, secret mission that will take him through the five boroughs of New York.

$9.96Details


Chessex Dice: Pound of Dice (Pound-O-Dice) Approximately 100 Die

For only the most extreme board game player or gambler.

$18.85Details

Magic Bullet MBR-1701 17-Piece Express Mixing Set

The magic bullet replaces a food processor, blender, and coffee grinder. Yet it occupies only the space of a coffee mug.

$38.49Details


The Golf Club Incrediball RTR RC Remote Control Golfball (Color May Vary)

A remote controlled golf ball that can be set to spin off in any direction you fancy at the flick of a switch.

$17.99Details

White Teeth: A Novel

Zadie Smith's dazzling debut caught critics grasping for comparisons and deciding on everyone from Charles Dickens to Salman Rushdie to John Irving and Martin Amis.

$10.85Details


Vera Bradley Convertible Kisslock in Lemon Parfait

A wallet by day and a purse by night, this convertible accessory is fun, flirty and large enough to hold a Smartphone.

$27.95Details

Michael Kors Quartz, Mother of Pearl Dial with White Acrylic Link Band - Womens Watch MK5079

It has an eye-catching mother-of-pearl dial and bezel that are adorned with crystals that glisten like diamonds.

$140.63Details


Never Let Me Go (Movie Tie-In Edition) (Vintage International)

All children should believe they are special. But the students of Hailsham, an elite school in the English countryside, are so special that visitors shun them, and only by rumor and the occasional fleeting remark by a teacher do they discover their uncon

$15.00Details

Metal Jewelry Stand Tree with an Antique Silver & Gold Finish

Iron Jewelry Tree Stand Unique tree design with leaves and branches Done in an antique silver/gold finish Works great for necklaces and bracelets and has 40 hanging positions

$23.99Details


The Remains of the Day

The Remains of the Day is a profoundly compelling portrait of the perfect English butler and of his fading, insular world postwar England.

$8.16Details

Elephant Ring Holder - Silver

Store your rings on this adorable elephant's trunk.

$24.99Details


Cloud Atlas: A Novel

In his captivating third novel, David Mitchell erases the boundaries of language, genre and time to offer a meditation on humanity’ s dangerous will to power, and where it may lead us.

$10.20Details

Envirosax Rosa RO.P Shoulder Bag,Multi,One Size

Envirosax shopping bags carry a message of sustainable living to a world ready to embrace a brighter ecological future.

$38.50Details


The Satanic Verses: A Novel

The Satanic Verses is Salman Rushdie's best-known and most galvanizing book. Set in a modern world filled with both mayhem and miracles, the story begins with a bang: the terrorist bombing of a London-bound jet in midflight.

$10.88Details

The Picture of Dorian Gray

Dorian Gray, a handsome young man, receives a beautiful painting of himself from his good friend Basil Hallward. In the same moment, a new acquaintance, Lord Henry, introduces Dorian to the ideals of youthfulness and hedonism, of which Gray becomes immed

$6.95Details


Lilly Pulitzer iPad & Netbook Sleeve - Nice To See You

Protect your iPad/NetBook in style.

$29.95Details

J. D. Salinger Boxed Set

Collect of J.D. Salinger's books such as Catcher in the Rye and Nine Stories.

$62.99Details


This Side of Paradise (Penguin Hardback Classics)

The story of a young man's painful sexual and intellectual awakening that echoes Fitzgerald's own career, it is also a portrait of the lost generation that followed straight on from the First World War, 'grown up to find all Gods dead, all

$16.50Details

Back to Basics TEM500 Egg-and-Muffin 2-Slice Toaster and Egg Poacher

The Egg & Muffin Toaster brings innovation to the toaster category by combining the functions of a toaster and an egg poacher into one easy-to-use appliance.

$34.00Details


Midnight in Paris

This is a romantic comedy set in Paris about a family that goes there because of business, and two young people who are engaged to be married in the fall have experiences there that change their lives. It's about a young man's great love for a

$17.99Details

3-D Mirascope

This super-cool toy creates a realistic 3D Holographic image from small objects, for hours of family fun.

$4.74Details


I Am Trying to Break Your Heart - A Film About Wilco

This splendid documentary captures the band Wilco's struggles (both with their record company and within the band itself) while recording their album Yankee Hotel Foxtrot.

$24.49Details

Loudquietloud - A Film About the Pixies

The Pixies' 2004 reunion was the biggest thing that's happened in alternative rock since Nirvana, and filmmakers Steven Cantor and Matthew Galkin were there with their cameras, trailing the genre's progenitors across North America and Euro

$9.86Details


Helter Skelter Drinks Chiller

Warm drinks are so 20th century.

$33.18Details

Wild Planet Lazer Tripwire

Warning alarms alert you to intruders, while 3 lazer units form a perimeter that protects your top secret stuff just like banks and museums use!

$19.92Details


Michael Kors Perfume for Women 1 oz Eau De Parfum Spray

Creamy florals explode into exotic spices, tamed by Moroccan incense. A fragrant creation with a wealth of personality that will capture the heart of every woman.

$69.99Details

Flowerbomb by Viktor & Rolf for Women - 3.4 Ounce EDP Spray

Launched by the design house of Viktor & Rolf.

$109.14Details


Trish Mcevoy No. 9 Blackberry & Vanilla Musk

TRISH MCEVOY NO. 9 BLACKBERRY & VANILLA MUSK by Trish McEvoy

$48.00Details

Iron Man 2 Macbook Decal Mac Apple skin sticker

A wise man once asked, Is it better to be feared or respected? I say, is it too much to ask for both?

$15.99Details


Jailbreak Collective Like and Dislike Stamps (Set)

Preloaded with enough ink for 5,000 assertions, the stamps give you the ability to emphatically thwack your opinion on tangible objects. Judge all the things.

$12.99Details

Satya Jewelry Silver Turquoise, Hamsa, Lotus Charm Necklace

Turquoise, the stone of healing, and the Hamsa which protects against negative energies, meet the lotus as a symbol of renewal and transformation.

$98.00Details


Bling Jewelry Sterling Silver Turquoise Five-strand Bracelet [Jewelry]

Five strands of hand-strung turquoise nuggets are attached to a .925 sterling silver bar clasp.

$39.99Details

Bling Jewelry Sterling Silver Elongated Teardrop Bangle Bracelet

This bracelet is great for every day wear and elegant for dressy affairs.

$49.99Details


Glow in the Dark Toilet Roll

Don't like turning the light on when you need an impromptu midnight wee? Your aim may be rubbish, but at least you can find the toilet paper thanks to our Glow in the Dark Toilet Roll!

$7.60Details

Stainless Steel Aqua Resin Dome Ring

Beautiful Stainless Steel Aqua Resin Dome Ring

$31.99Details


Hops Holster 12 Can Ammo Pack

When you're ready to wage war on thirst (and possibly sobriety) the Hops Holster 12 Can Ammo Pack is the only beer holder gear you need.

$39.95Details

Steve Jobs

Autobiography of Steve Jobs

$17.87Details


Nerf N-Force Marauder Long Sword - Black

A sword designed for full contact fighting.

$38.77Details

The 4-Hour Workweek: Escape 9-5, Live Anywhere, and Join the New Rich

Forget the old concept of retirement and the rest of the deferred-life plan-there is no need to wait and every reason not to.

$13.49Details


The 4-Hour Body: An Uncommon Guide to Rapid Fat-Loss, Incredible Sex, and Becoming Superhuman

Thinner, bigger, faster, stronger... which 150 pages will you read?

$16.47Details


The Prague Cemetery

What if, behind all of these conspiracies both real and imagined, lay one lone man? What if that evil genius created its most infamous document?

$14.88Details

Indian Healing Clay - 2 lbs - Clay

Aztec Secret Indian Healing Clay deep cleanses skin pores, removing dirt and impurities, lifting out poisons and toxins stored in the epidermis.

$7.52Details


(4gb MicroSD Bundle) US Mint 1/2 Dollar - Micro SD Card Covert Coin - Secret Compartment

Spy coin helps you turn every day objects into a secret compartment.

$34.99Details

Halo 3, Master Chief Costume, Adult Standard

Quilted jumpsuit with EVA armor, two-piece deluxe helmet, gauntlets and boot tops.

$580.46Details


The Feminine Mystique

This is the book that defined "the problem that has no name," that launched the Second Wave of the feminist movement.

$11.53Details

Wild Planet Lazer Tripwire

Warning alarms alert you to intruders, while 3 lazer units form a perimeter that protects your top secret stuff – just like banks and museums use!

$20.09Details


Sphere Pen Camera - Hidden Video Spy Pen

1.5 hours of high quality video stored on 4GB memory card.

$99.99Details

The Unraveler Action Figure

The Unralers are a product of the extensive and rigorous preservation of the Horadrim.

$29.99Details


Sword of Justice Diablo 1 Comic

Jacob finds his destiny in a desert cave at the foot of a mountain carved in two by the sword of an archangel - Tyrael.

$2.39Details


Kotobukiya Star Wars: Han Solo in Carbonite Silicon Tray

Freeze your own Han Solo! Here comes an innovative Star Wars kitchen product from a galaxy far, far away. This time around, the fun gets frosty with the Han Solo in Carbonite Silicone Tray.

$8.89Details

Ultra-Star 175G Ultimate Disc

The world standard for the sport of Ultimate, and the official disc of the USA Ultimate Championship Series.

$5.95Details


Step 2 Up & Down Roller Coaster

Let your child experience the up-and-down thrills of a roller coaster in the safety of your living room or driveway with the Up and Down Roller Coaster

$94.88Details

Star Wars Ultimate Darth Vader FX Lightsaber

Act just like Darth Vader with the Darth Vader Star Wars Ultimate FX Lightsaber, a glowing, humming, clashing Lightsaber that looks and feels just like the real thing.

$38.99Details


Victorinox Swiss Army Classic Pocket Knife

The Classic is the perfect pocket-size model, with seven functions, including tweezers and toothpick.

$17.50Details


Soft Heat Micro-Plush Top Low-Voltage Electric Heated Twin Mattress Pad, White

"Amazing" is the best word to describe this ultra-plush pad with its incredibly soft, supportive and luxurious Micro-Velour fabric top.

$65.99Details

Underground Toys Star Wars 9" Talking Plush - Chewbacca

This Classic talking Star Wars recreation of absolutely everyone's favorite Wookie, is incredibly cute and life like!

$25.08Details


Underground Toys Star Wars 9" Talking Plush - R2-D2

Why not take a load off and cuddle up with this wonderful, talking, soft plushes while war rages on between the Empire and the Rebel forces!

$22.34Details


Star Wars Darth Vader Helmet

Are you ready to feel like the villain to end all villains This detailed DARTH VADER electronic helmet will make the action feel incredibly real!

$19.97Details


Aurorae Classic Yoga Mats

Ultra Thick, Extra Long with Rising Moon Focal point Icon, Illuminating Colors, Eco Safe, Free from Phthalates and Latex

$34.95Details


Cards Against Humanity

Cards Against Humanity is a party game for horrible people. Unlike most of the party games you've played before, Cards Against Humanity is as despicable and awkward as you and your friends.

$25.00Details


Britax Frontier 85 Combination Booster Car Seat, Rushmore

The new Britax frontier 85 combination harness 2 booster boasts best in class forward-facing five-point harnessed weight capacity up to 85 pounds with an industry-leading 20" shoulder harness height.

$212.49Details


Swedish Firesteel - Army Model, Black Handle

Originally developed for the Swedish Department of Defense, Swedish FireSteel is a flash of genius. Its 3,000°C spark makes fire building easy in any weather, at any altitude.

$15.05Details

Custom HAND Painted Heels - Star Wars

THE VERY BEST CUSTOM STAR WARS HEELS YOU WILL FIND!

$275.00Details


Star Wars Art Prints Boba Fett R2D2 and C-3PO Art 3D Pop Artwork Droid Art

This Star Wars Art prints listing is for paper cut 3-D pop artwork featuring the galaxy's favorite bounty hunter Boba Fett and inter-galactic best buddies: R2-D2 and C-3PO.

$67.00Details

Eagles Nest Outfitters DoubleNest Hammock (Orange/Grey)

The DoubleNest seats more than one person comfortably and is essential for family adventures. The DoubleNest still packs down to the size of a grapefruit, so there is no excuse to be without your ENO hammock.

$64.95Details


LEGO Star Wars Millennium Falcon 7965

Straight from the Death Star escape scene of Episode IV: A New Hope

$126.99Details

Flash Cooking System Sapphire Blue 000 by JETBOIL

Designed to capture and focus heat more efficiently than traditional cooking systems, the Flash brings two cups of water to a boil in only two minutes.

$80.71Details


Acupressure Mat | Acupuncture Mat for Back Pain Relief | (nail bed or spike mat) (Green)

The Nayoya Mat uses the benefits of acupuncture to help the body repair itself, and heal itself from all kinds of stress such as back pain, fatigue, insomnia, high blood pressure, and muscular soreness.

$49.99Details

Funko Darth Vader Bobble - Head

This mighty warrior will watch over your desk and enforce the emperor's will on all who dare draw near.

$10.07Details


STAR WARS DOG hat costume yoda

Show your love of awesome things by dressing your furry monster up as Yoda this year!

$20.00Details

Star Wars X Wing Pilot Hoodie

This Star Wars X-Wing Pilot Hoodie is specifically customized to reflect Luke Skywalker's jumpsuit, visor and specific helmet designs.

$150.00Details


Adult R2-D2 Star Wars Beanie

Crocheted R2-D2 beanie hat for teens and adults.

$42.00Details



Girlbomb: A Halfway Homeless Memoir

A wry, mesmerizing portrait of being underprivileged, underage, and underdressed in 1980s New York City, Girlbomb provides an unflinching look at street life, survival sex, female friendships, and first loves.

$15.00Details

Kids Raptor Hoodie Shirt

If it wasn't for a giant meteor, dinosaurs would be living in cities instead of us. Honor those proud killing machines by wearing the Raptor hoodie. Go from docile dino to fearsome raptor in seconds.

$24.99Details


Sub Zero Macbook Decal Mac Apple skin sticker

Make your Mac Book go Sub-Zero in coolness.

$15.99Details

Stryker the Smoking Dragon Sculptural Incense Box

A peaceful house starts with dragons and incense.

$24.95Details


Electronic Guitar Shirt

You air guitar getting old? Step up your game with this rockstar guitar tshirt with built in mini amp.

$19.99Details

Bear Grylls Survival Series Ultimate Kit

The product of collaboration between Gerber and survival expert Bear Grylls, the Ultimate Kit is a 15-piece survival kit built for hostile environments.

$67.50Details


Portable Amp For Iphone Horn Stand White

Turn up the sound with science (and not your battery)

$24.99Details

Bamboo Wirelesskeyboard & Mouse

Environmentally friendly keyboard and mouse combo

$142.09Details


Big Mouth Toys Toilet Mug

A toilet bowl full of brown liquid, that's just tasteless. Or funny.

$10.97Details


Boyfriend Pillow

Want to cuddle but nobody is around? The boyfriend pillow will hold you, every night, all night.

$60.00Details

Nostalgia Electrics SCM-502 Vintage Collection Old Fashioned Snow Cone Maker

This old-fashioned, carnival-style snow cone maker cart shaves ice cubes into snow. Add your choice of flavored syrup. Now you can enjoy the wonderful cool taste of Snow Cones anytime in the convenience of your own home.

$67.00Details


Twelve South BookBook, 15-inch Hardback Leather Case for 15-inch MacBook Pro, Red

BookBook is a one-of-a-kind, hardback leather case designed exclusively for MacBook Pro.

$79.99Details

THE EX Kitchen Knife Set by Raffaele Iannello, Black

Not only functional, but also therapeutic, this five-piece knife set plus holder makes for the perfect gift and a guaranteed conversation piece.

$169.99Details


Credit Card Lightbulb

Never be afraid of the dark again. This mini light bulb is credit card size and can go with you anywhere.

$2.00Details

Swinging Sticks Kinetic Energy Sculpture

The Swinging Sticks Kinetic Energy Sculpture is a high end, museum quality moving display that is ideal for offices, lobbies, waiting rooms, and conference rooms.

$229.99Details


USBCELL AA Rechargable Battery

Can't find your charger? USBCELL AA Rechargeable Batteries work just like normal rechargeable batteries--but simply pop off the lid to recharge by any powered USB Port.

$19.95Details

Modern Single Handle Waterfall Bathroom Vanity Vessel Sink LED Faucet, Chrome

This amazing LED faucet changes color with the temperature of the water.

$59.99Details


World Of Warcraft Deluxe Latex Mask, Troll, Green, One Size

Sometimes I wish I could roam around the mall like it were Azeroth. Now I can with my World of Warcraft Troll Mask!

$36.99Details

BACON shaped themed Adhesive Bandages

Bacon Band Aids. Bacon really does fix everything.

$6.99Details


Peekaru Original Fleece Baby Carrier Cover Medium - Black

Share the warmth with your baby or toddler. The Peekaru Original is an environmentally friendly fleece vest that fits over you and your baby, keeping you both warm without giving up the comfort of your favorite baby carrier.

$79.95Details


Kotobukiya Samurai Sword Chopsticks Set: Date Masamune

The way of the warrior starts at the dinner table! Based off of real samurai warriors! Meals with honor!

$11.99Details

Clear Blue Hawaii Molokini 2 - Person Kayak

Transparent Molokini Kayak. Discover. Explore. See. Witness fascinating lake or sea life through the sleek transparent hull. This is a great investment whether your goal is serious research or a child's voyage of discovery.

$2,243.17Details


Kinect Star Wars

Feel the Force as you transform yourself into a Jedi. Fully harnesses the power of the Kinect platform to deliver a natural and intuitive Star Wars experience.

$49.96Details

Kurt Adler SW6101L Star Wars Nutcracker, Storm Trooper, 11-Inch

This 11-inch nutcracker is based on a Storm Trooper from the popular Star Wars series.

$35.67Details


Lego Star Wars: The Complete Saga

Play through the events of all 6 Star Wars movies in 1 videogame for the first time ever.

$17.29Details


RoomMates RMK1382SCS Star Wars: The Clone Wars Glow in the Dark Wall Decals

All the light sabers glow in the dark, need I say more?

$9.97Details

Stormtrooper Regrets T-Shirt

Those WERE The Droids You Were Looking For

$16.99Details


Star Wars Dinnerware Plate and Bowl - 2 Piece Set

Package includes 1 plate and 1 bowl Plate size 8 inches in diameter, bowl size is 5.75 inches in diameter.

$4.51Details

Meon Star Wars - Interactive Animation Studio

Make your own Star Wars animated signs that light up like Neon.

$11.99Details


Vandor 14 by 4 by 15-Inch Star Wars Large Recycled Shopper Tote, Multicolored

The Star Wars Large Recycled Tote is the perfect gift for any Star Wars fan.

$5.95Details

Revell Star Wars -Millennium Falcon

Perhaps the most iconic starship in the universe.

$35.61Details


Flared Star Wars Skirt

One of a kind Skirt. Flared Style. With Knit Waistband. M Waist 30-38

$25.00Details

Star Wars Cupcake Stencils

Our set includes Star Wars logo, Darth Vader, Yoda and a Stormtrooper

$19.99Details


Star Wars Lightsaber USB Glow Lamp

USB Light Saber Lamp

$31.00Details

Star Wars: Episode I-VI - Movie Poster (All Characters - With Space Ships) (Size: 36 x 24) Poster Print, 34x22

Star Wars: Episode I-VI - Movie Poster (All Characters - With Space Ships) (Size: 36 x 24)

$2.82Details


Framed Star Wars YODA best quotes text print

This is a limited edition TEXT art piece. The image is made up entirely of colored text.

$19.99Details

Star Wars Clone Wars Comforter - Twin

Star Wars Clone Wars Comforter.

$34.83Details


Handmade Star Wars Chewbacca Stuffed Plush Animal

Carry Chewie where ever you go! 20 inches tall with cute button eyes and a cute button nose! Handmade out of the softest fluffiest brown fur availabel! Comes with bandolier.

$28.00Details


Star Wars: The Complete Visual Dictionary - The Ultimate Guide to Characters and Creatures from the Entire Star Wars Saga

Provides a complete, comprehensive overview of the Prequel movies (Episodes I-III) and the Trilogy (Episodes IV-VI), this is the definitive photographic guide to the entire Star Wars saga.

$26.40Details


Boba Fett Star Wars Hat

Now you too can be digested by the Sarlac Pit Monster!

$49.99Details

Boba Grafetti baby tee

You should wait for the paint on your helmet to dry before launching head first into a sail barge, it may leave a nasty imprint of your defeat.

$18.95Details


Evolution of Evil T-Shirt

There has been a disturbance in the force, and it ain't good.

$19.95Details

Star Wars - Movie Poster (Darth Vader: Your Empire Needs You) (Size: 24" x 36")

Star Wars Movie Your Empire Needs You Darth Vader Poster Print - 24x36

$7.99Details


Ackbarpography t-shirt

Take a closer look and you'll discover the holy grail of science fiction one-liners... IT'S A TRAP!

$19.95Details


Stormtroopa t-shirt

When someone always rescues the princess, when a short stumpy plumber can dismantle an entire evil empire, when all the giant bombs and bullets of the world just aren't enough - it's time to consider the benefits of mass-production!

$19.95Details

Star Wars Deluxe Set of 6 Movie Posters From ALL the Star Wars Movies

6 STAR WARS MOVIE POSTERS on Quality Stock Paper One full size movie poster from each Star Wars Episode.

$32.99Details


Peek into the Dark Side t-shirt

What would you do with the power? We feel a breeze in the Force.

$19.95Details


Star Wars "Men of Distinction" set of two 11x17 prints (Darth Vader & Boba Fett), unframed

Have you ever wished for Star Wars-related art with class and distinction? Look no further; this dark lord and bounty hunter duo knows how to settle things like true gentlemen.

$20.00Details

Star Wars: The Clone Wars - The Complete Season One

This new TV series takes place immediately after the events of Star Wars-Episode II: Attack of the Clones.

$44.98Details


Star Wars 10 oz Glasses, Set of 4

1 each of Princess Leia, Darth Vader, Luke Skywalker, and Han Salo

$25.00Details

Fanboys

Get ready for the comedy adventure that's "smart, funny, and tailor-made for the inner-Jedi in all of us"

$6.49Details


Vandor 18-Ounce Ceramic Mug, Star Wars Yoda

You don't need to travel to a galaxy far, far away to find your favorite classic Star Wars characters.

$19.26Details

Star Wars: The Old Republic

Star Wars: The Old Republic is a Massively Multiplayer Online Role-playing Game

$59.95Details


Presto 03430 Pizzazz Pizza Oven

The fast and easy way to bake fresh or frozen pizza. Great for frozen, homemade, take-and-bake, or deli pizza. The easy way to prepare chicken nuggets, quesadillas, fish fillets, even grilled sandwiches.

$39.96Details


Diablo III: Book of Cain

Diablo III: Book of Cain is Cain's formal record of this greater tale - a dissertation on the lore of the Diablo universe, told by one who has witnessed and participated in some of the epic events that make up the eternal conflict.

$23.10Details

Diablo Health and Mana Potion Earrings

Now these are for the ULTIMATE Diablo fan!! The potion bottles are made of glass with a sealed cork.

$12.99Details


Lightphoria 10,000 lux SAD Light Therapy Pad (Seasonal Affective Disorder) Sunlight Simulator. 2011 model (v2.1)

Bright light has been used for over a decade to alleviate symptoms associated with Seasonal Affective Disorder (SAD), jetlag, shift work fatigue, insomnia, seasonal change and more.

$99.99Details

Diablo Archive

Diablo Archive is a collection of three novels and a short story, set in the world of Blizzard Entertainment's Diablo franchise.

$12.23Details


LeapFrog Fridge Farm Magnetic Animal Set

Moo! Oink! Bow-wow! Toddlers from one to five years old will love making wacky animal combinations with this LeapFrog Magnetic Animal set.

$15.87Details


Birthright (Diablo: The Sin War, Book 1) (Bk. 1)

This is the tale of the Sin War - the conflict that would forever change the destiny of man.

$7.99Details


Sterling Silver Peridot, Garnet, Amethyst, Blue Topaz and Citrine Individually Boxed Stud Earring Set

Add sparkle and variety to your wardrobe with this set of five individually boxed sterling silver stud earrings, showcasing five different colored gemstones.

$41.99Details

Diablo 3 Towel

Made of 100 percent cotton and custom threaded for maximum comfort and absorbency

$29.00Details


Henry Darger

This large-format, lavishly illustrated volume presents the iconic American outsider artist in a new critical light, locating him for the first time as a major figure in the history of contemporary art.

$53.55Details


Diablo 3 Rainbow T-Shirt

Blizzard Entertainment's newest title Diablo III is filled with rainbows and sunshine!

$22.00Details


Vtech Kidizoom Plus Digital Camera - Blue

Little ones will have a blast taking candid pics with their Kidizoom Camera. Kidizoom includes a connector cable to plug in and watch a picture slideshow or view the 5-minute movies they've created on any TV or PC.

$89.99Details

This Is Why You're Fat: Where Dreams Become Heart Attacks

It was the birth of the nasty food web-trend. And it was delicious.

$9.99Details


Life

With The Rolling Stones, Keith Richards created the songs that roused the world, and he lived the original rock and roll life. Now, at last, the man himself tells his story of life in the crossfire hurricane.

$11.55Details


Full Rejuvenation Potion

Instantly restores 100% Life and Mana

$18.00Details

Pelican 1170 Carrying Case for Multi-Purpose - Black

Hand-held electronics protection solution. Watertight, crushproof, and dust proof. Easy open Double Throw latches. Open cell core with solid wall design - strong, light . O-ring seal. Automatic Pressure Equalization Valve. Pick N Pluck with convoluted li

$34.24Details


Doctor Who 11 Doctors 5" Action Figure Collector Set

This boxed set features 5 inch figures of the eleven men to portray the Doctor in the BBC series, with new costumes and new sculpts.

$99.99Details

Diablo III Special Edition Premium Tee S

Are you brave enough to challenge the Burning Hells, and take arms against the demons that lie in wait?

$21.99Details


The George R.R. Martin Song Of Ice and Fire Hardcover Box Set featuring A Game of Thrones, A Clash of Kings, A Storm of Swords, and A Feast for Crows (Amazon Exclusive)

George R. R. Martin has created a world that is as rich and vital as any piece of historical fiction, set in an age of knights and chivalry and filled with a plethora of fascinating, multidimensional characters that you love, hate to love, or love to hat

$86.31Details

Silk Nightgown and Robe Set - Royal Peacocks

The robe, on the back, features a pair of majestic peacocks perched on a tree brimming with deep red autumn colors. The painting flows into the front of the robe as well as the gown.

$159.00Details


Hand Held Scalp Head Massager - Set of Three ( Colors May Vary )

It relieves tension as it softly massages acupressure points and stimulates sensitive nerves in your scalp.

$19.99Details

Diablo 2012 Wall Calendar 12" X 12"

This calendar's twelve images of the Diablo III universe-an ethereal realm-will mesmerize fans of the game and dark-fantasy aficionados alike.

$13.98Details


Tyrael Hoodie

Bring forth the power of the Archangel of Justice and don his mighty mantle, equipped with a cowl hood and tendrils on back.

$69.99Details


Thera Cane Massager

Thera Cane self-massage device uniquely designed to apply pressure to sore muscles.

$29.95Details

Cuisinart GR-4N 5-in-1 Griddler

Compact in size but big in features, Cuisinart's countertop Griddler offers five-in-one functionality as a contact grill, panini press, full grill, full griddle, and half grill/half griddle.

$80.25Details


Transformer USB Flash Memory Drive 4GB

This USB drive transforms from Leopard to USB stick in seconds.

$9.80Details

Diablo 3 Mistress of Pain Socks

With an elegant design taken directly from Cydaea herself, the Mistress of Pain Socks are sure to give your favorite someone a good taste of Sanctuary while we patiently await what's to come.

$11.99Details


TOTO Washlet - Temperature Controlled Toilet Seat

Cold Toilets are so yesterday.

$409.86Details

Diablo III Tyrael Side Premium Tee

Following the Dark Exile, Tyrael created the Horadrim and destroyed the Worldstone to protect Sanctuary and contain the Prime Evils forever.

$21.99Details


Fogless Shower Mirror with Squeegee by ToiletTree Products. Guaranteed Not to Fog, Designed Not to Fall.

Look your best by taking care of your face in your shower. This patent pending mirror is guaranteed not to fog in the shower.

$34.95Details

Presto Pro EverSharp Electric Knife Sharpener

Razor sharp knives whenever you want - easy, automatic. Professional two-stage system sharpens in seconds. Blade guides automatically hold knife at ideal sharpening angle.

$27.00Details



AeroGarden 2101-00B Classic Garden 7-Pod With Gourmet Herb Seed Kit - Black

Enjoy the taste and fragrance of fresh herbs, vegetables and salad greens grown right in your kitchen. The AeroGarden grows them all with no dirt, mess or pesticides.

$149.95Details


Satechi CR -3600 car holder mount for iPhone 4S, 4, 3G & 3GS, BlackBerry Torch, HTC EVO, DROID, Samsung EPIC on Windshield and Dashboard

Using a smartphone as a GPS? Mount it in your car properly just like a traditional GPS.

$29.99Details

Melissa & Doug Deluxe Magic Set

Amazing multi-piece sets feature amusing illusions and crafty slight-of-hand tricks for the young magician to practice and perform.

$26.29Details


Pwned Mug

PWNED.

$9.99Details


Tyrael Premium Tee

Heralding from the Pandemonium Fortress, Tyrael is a character of mystery, with great tendrils of light emerging from his back which double as wings.

$21.99Details

Blendtec Total Blender Four Side, Black

It’s an all-in-one appliance that makes smoothies, fresh juice, ice cream, milkshakes, cappuccinos, margaritas, soups, sauces, breads, dressings, salsas, and more.

$399.99Details


All American 921 21-1/2-Quart Pressure Cooker/Canner

This heavy-duty pressure cooker's large capacity is probably best utilized for canning (though it would also be great for a number of cooking tasks).

$199.99Details

Something to Read on the Plane

A delightfully light-hearted variety of stories, articles, limericks, and even a quiz to see how good a passenger you are.

$0.99Details


Diablo III Woven Shirt

For the classy Diablo 3 Geek

$44.99Details

Snap Circuits Jr. SC-100

Curious young minds can learn the basics of electronics as they build more than 100 exciting projects with this kit. Work on projects that make sound effects, engineer different types of alarms, build touch circuits and play games.

$18.00Details


Munchkin Mozart Magic Cube

A true breakthrough in music education, the Munchkin Mozart Magic Cube will be music to your baby's ears.

$15.00Details

Diablo III Skeleton King Premium Tee

King Leoric, now risen from his eternal sleep as the Skeleton King, he commands a legion of undead minions beneath the Cathedral.

$21.99Details



Weber 386002 Q 100 Portable Propane Gas Grill

The grill ignites at the push of a button for reliable lighting, and an infinitely adjustable burner valve with a high-quality regulator makes it easy to control the heat.

$134.24Details

Carhartt Women's Sandstone Sierra Jacket/Sherpa-Lined,Black,Medium

Our sandstone sierra jacket is sherpa-lined for added warmth. It's made of 12-ounce, 100% cotton sandstone duck and features princess back seams for a premium fit, built-in bi-swing for ease of movement, interior rib-knit storm cuffs, two inside poc

$89.68Details


Diablo Battlechest [new version]

Get Diablo, Diablo 2 and Diablo 2: Lord of Destruction.

$29.99Details

Sigma Beauty Flat Top Synthetic Kabuki - F80

This exclusive Flat Top Synthetic Kabuki was designed to deliver a flawless makeup application.

$23.38Details


Diablo II - 1 inch Pinback Buttons

Brand new set of 4 1" pin-back buttons, great for any fan of the series!

$3.00Details

Christmas In the Heart

2009 holiday release, the first Christmas album from the legendaryFolk/Rock singer/songwriter.

$10.99Details


Diablo III

Shut up and take my money Blizzard.

$59.99Details

© Gift Lizard 2011