×

Find gifts by describing the person you are trying to buy for. Use things like who they are (dad), their hobbies (star wars), their personality (geek, gamer).

You searched for: geekstar warsgamesminecraftkitchencamping

Reset Tags. (Click a tag to remove it. Add tags on the left side.)

Star Wars Interactive R2D2

Dancing to Cantina Music, bringing you drinks and guarding your precious stuff. What more could you ask for from the most faithful robot in the galaxy?

$199.99Details


Jedi Dressing Gowns - Star Wars Bath Robes

Those aren't the droids you're looking for.

$88.44Details


Wookiee Cookies: A Star Wars Cookbook

Tusken Raider Taters, Yoda Soda, C-3PO Pancakes... mmmm sounds delicious!

$18.99Details


Star Wars Storm Trooper USB Drive 4GB

Storm Trooper USB stick.

$34.99Details

Think Geek Star Trek Enterprise Pizza Cutter

Boldly go where no pizza has gone before with Think Geek's Star Trek Pizza Cutter.

$24.99Details


Radica 20Q Artificial Intelligence Game - Colors may vary since the item may come in 3 different colors

I didn't believe it would work, but I tested the online version and it got 'Satellite' correct. Impressed.

$19.99Details

Men's Play Money Tie by Fun Ties in Black

This unique novelty tie features colorful play money on a durable black polyester fabric. This necktie is worth a million dollars, well a million dollars in play money.

$25.00Details


LEGO Star Wars Ultimate Collector's Millennium Falcon

Han Solo's famous starship is crafted from over 5,000 Lego pieces.

$499.99Details

Kurt S. Adler 10-Light Star Wars R2D2 Light Set

This novelty light set features 10 R2D2 lights with 30-inch lead wire and 12-inch spacing.

$30.00Details


Mindflex Duel Game

Mindflex Duel is the ultimate head-to-head brain game challenge

$74.99Details

Pleo Dinosaur - A UGOBE Life Form

Pleo looks, moves, sounds and behaves like a living creature. Fully aware and cognitive, he explores his environment and interacts with people, accessories and other UGOBE dinosaurs.

$508.08Details


Star Wars: The Complete Saga (Episodes I-VI) [Blu-ray]

The Ultimate Sci-Fi Series on Blu-Ray.

$86.99Details

Sci Fi Reference t-shirt

This is our remastered Sci-Fi movies reference t-shirt.

$19.95Details


Operation Star Wars Edition

R2D is on the blink and looking for a steady hand to help. Can you repair a cranky crankshaft or a hiccupping hologram?

$26.93Details

LEGO Kids' 9002137 Star Wars Storm Trooper Mini-Figure Alarm Clock

A superb character mini figure style clock from the masters at Lego, featuring Alarm and a Snooze Button!

$23.99Details


Smart Planet CDM-1 Corn Dog Maker

Make your very own corn dogs

$24.99Details

THE EX Kitchen Knife Set by Raffaele Iannello, Black

Not only functional, but also therapeutic, this five-piece knife set plus holder makes for the perfect gift and a guaranteed conversation piece.

$169.99Details


Swinging Sticks Kinetic Energy Sculpture

The Swinging Sticks Kinetic Energy Sculpture is a high end, museum quality moving display that is ideal for offices, lobbies, waiting rooms, and conference rooms.

$229.99Details


Sub Zero Macbook Decal Mac Apple skin sticker

Make your Mac Book go Sub-Zero in coolness.

$15.99Details

USBCELL AA Rechargable Battery

Can't find your charger? USBCELL AA Rechargeable Batteries work just like normal rechargeable batteries--but simply pop off the lid to recharge by any powered USB Port.

$19.95Details


Stryker the Smoking Dragon Sculptural Incense Box

A peaceful house starts with dragons and incense.

$24.95Details

World Of Warcraft Deluxe Latex Mask, Troll, Green, One Size

Sometimes I wish I could roam around the mall like it were Azeroth. Now I can with my World of Warcraft Troll Mask!

$36.99Details


Air Swimmer Remote Control Inflatable Flying Shark

Flying Sharks. Who wouldn't want one?

$39.99Details


Harvil Tabletop Air Hockey Table

The Harvil Tabletop Air Hockey Table is a lightweight and affordable way to introduce the fun of air hockey to children.

$149.44Details

Portable Amp For Iphone Horn Stand White

Turn up the sound with science (and not your battery)

$24.99Details


Zen Magnets - Gift and Retail Packed Zen Set

Zen Magnets. These super powerful and tiny magnets are a lot of fun for kids and adults.

$59.95Details

Bamboo Wirelesskeyboard & Mouse

Environmentally friendly keyboard and mouse combo

$142.09Details


Handcrafted Figured Mahogany Case for iPhone 4/4S

Protect your phone with classic style.

$69.95Details

Bath Tissue Tyrant: Commode Dragon

Some dragons are helpful. Rest peacefully knowing this dragon is guarding the most important thing in the room.

$34.95Details


Fred and Friends PIBOSS Pizza Boss Pizza Wheel

Sick of cutting pizza with a knife? Tired of cutting yourself with a pizza cutter?

$15.00Details

Nintendo Wall Graphics - Super Mario Bros

Level up your room with this Mario Themed wall graphics.

$74.95Details


Cake Pop & Donut Hole Bakery

Make your own donut holes at home!

$24.99Details

Super Mario Time to Team Up 50-by-60-Inch Microraschel Throw Blanket

Mario and Luigi race to save the game surrounded by icons and characters from your favorite video game. Cuddle up in this warm throw for a long day of video game fun.

$29.99Details


Adjust-A-Cup 2-Cup Measuring Cup

Tired of having to deal with tons of different measurement cups and spoons? This elegant adjustable measuring cup solves everything.

$12.99Details

MATH CLASS Wall Clock mathematics teacher classroom gift

I probably will never know what time it is again.

$22.99Details


Tailgate Folding Wooden Picnic Table

Have a picnic anywhere with the comfort of your own personal picnic table.

$134.99Details

Kymera Magic Wand Remote Control

Imagine walking into the room with your children and their Muggle friends watching TV, whipping out a magic wand from under your jacket and changing the channel in a flash.

$89.99Details


Obol, the Never-Soggy Cereal Bowl

Soggy cereal is a problem of the past.

$19.99Details

About Face 3: The Essentials of Interaction Design

This completely updated volume presents the effective and practical tools you need to design great desktop applications, Web 2.0 sites, and mobile devices. This book will teach you the principles of good product behavior.

$45.00Details


Don't Make Me Think: A Common Sense Approach to Web Usability, 2nd Edition

100,000 copies sold. If you do anything web related, this book is a must read.

$40.00Details

Sea to Summit Pocket Shower

Bring an 8 minute shower anywhere you go. Also works as a regular dry sack.

$24.21Details


The Design of Everyday Things

Anyone who designs anything to be used by humans--from physical objects to computer programs to conceptual tools--must read this book, and it is an equally tremendous read for anyone who has to use anything created by another human.

$15.95Details

Sport-Brella Umbrella Chair, Blue

Tired of all the shady spots being taken? Bring your own chair and shade together!

$39.99Details


Electronic Guitar Shirt

You air guitar getting old? Step up your game with this rockstar guitar tshirt with built in mini amp.

$19.99Details

Emile Henry Flame Top Pizza Stone, Black

Create marvelous pizzas at home.

$50.00Details


Bear Grylls Survival Series Ultimate Kit

The product of collaboration between Gerber and survival expert Bear Grylls, the Ultimate Kit is a 15-piece survival kit built for hostile environments.

$67.50Details

Men's Tetris Tie by Game Tie in Black

The classics of menswear and video games have finally come together to bring you this remarkable men's Tetris necktie.

$35.00Details


Garden Zombie

There's A Zombie On Your Lawn! Nobody was quite sure what caused it. An alien pathogen riding the tail of Halley's Comet? Some government "rage" virus? Radiation from a downed satellite?

$89.99Details

All My Friends Are Dead

All My Friends Are Dead presents a delightful primer for laughing at the inevitable.

$9.95Details


Aperture Science Mug

Welcome to Aperture Laboratories, A Trusted Friend in Science!

$12.99Details

Cards Against Humanity

Cards Against Humanity is a party game for horrible people. Unlike most of the party games you've played before, Cards Against Humanity is as despicable and awkward as you and your friends.

$25.00Details


Sphere Pen Camera - Hidden Video Spy Pen

1.5 hours of high quality video stored on 4GB memory card.

$99.99Details

Swedish Firesteel - Army Model, Black Handle

Originally developed for the Swedish Department of Defense, Swedish FireSteel is a flash of genius. Its 3,000°C spark makes fire building easy in any weather, at any altitude.

$15.05Details


Silver Robot 8GB Flash Drive

When it comes to file storage, you want something as reliable as your favorite lovable robot.

$44.99Details

Uncle Milton Star Wars Science Death Star Planetarium

This table top Death Star opens up into a planetary projector to display the cosmos on your bedroom ceiling.

$19.88Details


Reamde: A Novel

Reamde is a swift-paced thriller that traverses worlds virtual and real. Filled with unexpected twists and turns in which unforgettable villains and unlikely heroes.

$18.99Details

Camelbak M.U.L.E. 100 oz Hydration Pack, Chili Pepper/Charcoal

The M.U.L.E. NV from Camelbak is a narrow-gauge pack for 3+ hours of all-terrain adventures in any weather.

$69.98Details


Pool Table, Tabletop

Mini pool table.

$39.95Details

Star Wars Ultimate Darth Vader FX Lightsaber

Act just like Darth Vader with the Darth Vader Star Wars Ultimate FX Lightsaber, a glowing, humming, clashing Lightsaber that looks and feels just like the real thing.

$38.99Details


Flash Cooking System Sapphire Blue 000 by JETBOIL

Designed to capture and focus heat more efficiently than traditional cooking systems, the Flash brings two cups of water to a boil in only two minutes.

$80.71Details



Iron Man Mark II 12 Inch Deluxe Figure

This is a must for any collector Iron Man in this full body titanium color suit just like thr prototype in the movie.

$999.99Details

Underground Toys Star Wars 9" Talking Plush - Chewbacca

This Classic talking Star Wars recreation of absolutely everyone's favorite Wookie, is incredibly cute and life like!

$25.08Details


The Golf Club Incrediball RTR RC Remote Control Golfball (Color May Vary)

A remote controlled golf ball that can be set to spin off in any direction you fancy at the flick of a switch.

$17.99Details

Star Wars X Wing Pilot Hoodie

This Star Wars X-Wing Pilot Hoodie is specifically customized to reflect Luke Skywalker's jumpsuit, visor and specific helmet designs.

$150.00Details


Multi Green Laser 5mw

As seen on ghost hunters. You know it is legit now!

$11.75Details

Underground Toys Star Wars 9" Talking Plush - R2-D2

Why not take a load off and cuddle up with this wonderful, talking, soft plushes while war rages on between the Empire and the Rebel forces!

$22.34Details


Desktop Warfare Kits (Catapult)

Your own personal catapult.

$25.99Details

Infrared Mini Radio Controlled Marine Cobra Helicopter Gyro

Mini remote control helicopter. USB charger.

$24.94Details


Star Wars Darth Vader Helmet

Are you ready to feel like the villain to end all villains This detailed DARTH VADER electronic helmet will make the action feel incredibly real!

$19.97Details

Kate Spade iPhone 4 Tropical

This fun striped pattern is done in bold shades of lavender, yellow-gold,blue, fuschia, pink and lime.

$25.00Details



Cuponk Boomshakalaka

Sink your ball into the cup and light it up. Get it in and you'll hear the sweet sounds of victory.

$19.77Details

Roulette Shot Glass Bar Drinking Game Set

The party starts when the ball stops rolling!

$29.99Details


Back to Basics TEM500 Egg-and-Muffin 2-Slice Toaster and Egg Poacher

The Egg & Muffin Toaster brings innovation to the toaster category by combining the functions of a toaster and an egg poacher into one easy-to-use appliance.

$34.00Details


Magic Bullet MBR-1701 17-Piece Express Mixing Set

The magic bullet replaces a food processor, blender, and coffee grinder. Yet it occupies only the space of a coffee mug.

$38.49Details


Shower Shock Caffeinated Soap

the original and world's first caffeinated soap from ThinkGeek. When you think about it, ShowerShock is the ultimate clean buzz ;)

$6.99Details

Custom HAND Painted Heels - Star Wars

THE VERY BEST CUSTOM STAR WARS HEELS YOU WILL FIND!

$275.00Details


Bodum Brazil 8 cup French Press Coffee Maker, 34 oz, Black

Bodum Brazil offers a classic take on modern, functional design that will never go out of style.

$16.99Details

Star Wars Art Prints Boba Fett R2D2 and C-3PO Art 3D Pop Artwork Droid Art

This Star Wars Art prints listing is for paper cut 3-D pop artwork featuring the galaxy's favorite bounty hunter Boba Fett and inter-galactic best buddies: R2-D2 and C-3PO.

$67.00Details


Wii Classic Controller Pro - Black

Created for accessibility and comfort, the Classic Controller Pro blends design elements from game systems such as the NES, Super NES, and Nintendo 64 providing seamless play control for a wide range of games.

$19.99Details

Iron Man 2 Macbook Decal Mac Apple skin sticker

A wise man once asked, Is it better to be feared or respected? I say, is it too much to ask for both?

$15.99Details


LEGO Star Wars Millennium Falcon 7965

Straight from the Death Star escape scene of Episode IV: A New Hope

$126.99Details

Pantone Universe Mug Violet 7672

The PANTONE UNIVERSE mugs by Whitbread Wilkinson are made with fine bone china.

$15.95Details


Star Wars Science - Force Trainer

May the Force be with you! The Force Trainer by Uncle Milton actually allows you to control a Jedi Training Remote with your mind, by tapping into cutting-edge brainwave technology.

$35.95Details

Star Wars Chewbacca Back Buddy Plush

Now Chewy can join you everywhere you go.

$45.00Details


Funko Darth Vader Bobble - Head

This mighty warrior will watch over your desk and enforce the emperor's will on all who dare draw near.

$10.07Details

Doctor Who 11 Doctors 5" Action Figure Collector Set

This boxed set features 5 inch figures of the eleven men to portray the Doctor in the BBC series, with new costumes and new sculpts.

$99.99Details


Fred & Friends Beat It Chopsticks Set

One end of each chopstick is a regualr chopstick shape while the other end of of the chopstick is in the shape of a drumstick.

$14.99Details

STAR WARS DOG hat costume yoda

Show your love of awesome things by dressing your furry monster up as Yoda this year!

$20.00Details


Gerber 31-000751 Bear Grylls Survival Series Ultimate Knife, Serrated Edge

Intricately designed by Gerber and Bear, it's loaded with innovations that won't be found in any other fixed blade knife. Like everything in the Survival Series, it also includes Bear's Priorities of Survival pocket guide.

$42.13Details

IMCG Fridge Monkey - Charcoal

Bottles, Cans and drinks in general shouldn't fall out of the fridge ever again.

$7.99Details


Adult R2-D2 Star Wars Beanie

Crocheted R2-D2 beanie hat for teens and adults.

$42.00Details

Transformer USB Flash Memory Drive 4GB

This USB drive transforms from Leopard to USB stick in seconds.

$9.80Details


Sea To Summit Ultra-Sil Daypack

Backpack that fits on a keychain.

$26.96Details

Ultra-Star 175G Ultimate Disc

The world standard for the sport of Ultimate, and the official disc of the USA Ultimate Championship Series.

$5.95Details


Ten One Design Fling Game Controller - Ninja

Fling is a tactile game controller for iPad.

$9.50Details

Levitron AG Anti-Gravity Globe

Observe Earth levitate in space - only touching air!

$79.99Details


Victorinox Swiss Army Classic Pocket Knife

The Classic is the perfect pocket-size model, with seven functions, including tweezers and toothpick.

$17.50Details



Halo 3, Master Chief Costume, Adult Standard

Quilted jumpsuit with EVA armor, two-piece deluxe helmet, gauntlets and boot tops.

$580.46Details


Learning Resources Zoomy Handheld Digital Microscope

Amazing all-in-one digital microscope takes scientific inquiry to a new level - yet is easy for even a young child to use.

$59.95Details


Swiss+Tech UKCSB-1 Utili-Key 6-in-1 KeyChain MultiTool

The lightest and most compact multi-use tool ever developed.

$7.50Details

Sir Creeper of Minecraftia

Sir Creeper is a lover of all things expensive, and your newly acquired diamond is looking really good to him right now.

$24.54Details


Numi Organic Tea Flowering Gift Set in Handcrafted Mahogany Bamboo Chest: Glass Teapot & 6 Flowering Tea Blossoms

Packaged in an exotic hand-made dark mahogany bamboo case, this Flowering Gift Set is filled with six bouquets of tea leaves that blossom into a myriad of flavors from sweet and subtle to rich and bold.

$21.75Details

Don't Fear the Creeper (Sticker)

There's nothing to fear, all he has is an explosive personality!

$2.40Details


Presto 03430 Pizzazz Pizza Oven

The fast and easy way to bake fresh or frozen pizza. Great for frozen, homemade, take-and-bake, or deli pizza. The easy way to prepare chicken nuggets, quesadillas, fish fillets, even grilled sandwiches.

$39.96Details

Skull & Pickaxes (Sticker)

The traditional Skull & Crossbones with an added Minecraft twist!

$2.40Details


Adagio Teas 16-Ounce Ingenuitea Teapot

Great for the office or when traveling, this innovative teapot releases infused tea into a drinking cup. When tea is ready, simply place it atop the cup, causing a valve at the bottom to release and crystal-clear tea to flow down.

$17.45Details

Got Wood?

T-Shirt (Also available as Hoodie)

$24.54Details


Creeper Mousepad

You'll receive one cloth topped mousepad that is backed with non-slip, non-marking rubber.

$12.00Details

Cuisinart GR-4N 5-in-1 Griddler

Compact in size but big in features, Cuisinart's countertop Griddler offers five-in-one functionality as a contact grill, panini press, full grill, full griddle, and half grill/half griddle.

$80.25Details


Minecraft Diamond Ring

The ring is adjustable, and the figure is made from Polymer clay. It is painted with acrylic paint and finished with Min-Wax polycrylic to seal and protect it.

$10.00Details

MIU France Zinc Alloy Connoisseur Corkscrew Wine Opener

The next best thing to an in-house sommelier, this professional-quality wine opener offers the same impressive performance and stylish design as corkscrews that cost far more.

$20.99Details


Minecraft inspired Grass Cube Tissue Box Cover

Save your desk or nightstand from those ugly cardboard tissue boxes!

$18.00Details

Presto Pro EverSharp Electric Knife Sharpener

Razor sharp knives whenever you want - easy, automatic. Professional two-stage system sharpens in seconds. Blade guides automatically hold knife at ideal sharpening angle.

$27.00Details


AeroGarden 2101-00B Classic Garden 7-Pod With Gourmet Herb Seed Kit - Black

Enjoy the taste and fragrance of fresh herbs, vegetables and salad greens grown right in your kitchen. The AeroGarden grows them all with no dirt, mess or pesticides.

$149.95Details


Minecraft Diamond Earrings

Advertise your love for Minecraft with these rare gems! Here is a pair of gorgeous diamond earrings, straight from the depths of my private mine. Diamonds *are* a miner's best friend.

$10.00Details

All American 921 21-1/2-Quart Pressure Cooker/Canner

This heavy-duty pressure cooker's large capacity is probably best utilized for canning (though it would also be great for a number of cooking tasks).

$199.99Details


3D Pig from Minecraft

Oink! Oink!

$20.00Details

PUR 18 Cup Dispenser with One Pitcher Filter DS-1800Z

Keep your water clear of chemicals and odors with this dispenser from PUR. Its advanced filtration system reduces more contaminants (lead, copper, zinc, etc.) than any other pour-through filter.

$27.81Details


Minecraft Diamond Tool/Weapon Magnet Set

Each magnet has at least one strong round magnet or bar magnet so they're not only fun but functional. See my shop for other Minecraft sets, including this one in iron and gold.

$10.00Details


Minecraft University Hoodie

Ad Gloriam et Porcos (For pigs and glory!)

$59.99Details


Minecraft Note Cube

Leaves no cobblestone residue once fully mined

$14.95Details


Fasta Pasta The Microwave Cooker

No waiting for a big pot of water to boil. Cook pasta to al dente perfection in the microwave! Saves time, energy and water.

$8.99Details

Minecraft Sheet Magnets

80 1" square blocks on each sheet (2 sheets)

$21.53Details


Bananagrams

The Anagram game that will drive you bananas. The award-winning word game that needs no pencil, paper, or board. Fast and fun.

$14.95Details

Minecraft Drop it Creep Premium Tee S

A Creeper bounces his way up to an unsuspecting clerk, Give me all your money, bookworm, or I blow up your brainssssSSSsss!

$21.99Details


Blendtec Total Blender Four Side, Black

It’s an all-in-one appliance that makes smoothies, fresh juice, ice cream, milkshakes, cappuccinos, margaritas, soups, sauces, breads, dressings, salsas, and more.

$399.99Details

Minecraft Foam Pickaxe

The Minecraft Foam Pickaxe is made from sturdy EVA foam, which means that unlike the stone pickaxe in the game, the Minecraft Foam Pickaxe will withstand far more than 132 uses.

$49.99Details


Vinturi Essential White Wine Aerator

Specially designed to aerate white wine and produce better bouquet, enhanced flavors and smoother finish

$42.89Details

Minecraft Creeper Anatomy T-Shirt

The Creeper (Creepus explodus) is an all-terrain combustible terror of destruction, indigenous to dark caves found deep beneath the earths crust, and luxurious neighborhoods with glass houses and nice fancy everythings.

$19.99Details


Minecraft Confused Shirt

We presume that to a denizen of Minecraft spheres would be sort of like what non-Euclidean geometry is to us.

$19.99Details

Star Wars: The Complete Visual Dictionary - The Ultimate Guide to Characters and Creatures from the Entire Star Wars Saga

Provides a complete, comprehensive overview of the Prequel movies (Episodes I-III) and the Trilogy (Episodes IV-VI), this is the definitive photographic guide to the entire Star Wars saga.

$26.40Details


Minecraft Creeper T-Shirt

Embrace your inner Creeper!

$19.99Details

Boba Grafetti baby tee

You should wait for the paint on your helmet to dry before launching head first into a sail barge, it may leave a nasty imprint of your defeat.

$18.95Details


Eat Sleep Minecraft T-Shirt

Eat, Sleep Minecraft

$23.52Details

Star Wars Bath Playset

Includes R2D2, C3PO, Yoda, Darth Vader, Boba Fett, Stormtrooper, and Chewbacca

$35.99Details


Evolution of Evil T-Shirt

There has been a disturbance in the force, and it ain't good.

$19.95Details

Star Wars - Movie Poster (Darth Vader: Your Empire Needs You) (Size: 24" x 36")

Star Wars Movie Your Empire Needs You Darth Vader Poster Print - 24x36

$7.99Details


Ackbarpography t-shirt

Take a closer look and you'll discover the holy grail of science fiction one-liners... IT'S A TRAP!

$19.95Details


Stormtroopa t-shirt

When someone always rescues the princess, when a short stumpy plumber can dismantle an entire evil empire, when all the giant bombs and bullets of the world just aren't enough - it's time to consider the benefits of mass-production!

$19.95Details

Star Wars Deluxe Set of 6 Movie Posters From ALL the Star Wars Movies

6 STAR WARS MOVIE POSTERS on Quality Stock Paper One full size movie poster from each Star Wars Episode.

$32.99Details


Peek into the Dark Side t-shirt

What would you do with the power? We feel a breeze in the Force.

$19.95Details


Star Wars "Men of Distinction" set of two 11x17 prints (Darth Vader & Boba Fett), unframed

Have you ever wished for Star Wars-related art with class and distinction? Look no further; this dark lord and bounty hunter duo knows how to settle things like true gentlemen.

$20.00Details

Star Wars: The Clone Wars - The Complete Season One

This new TV series takes place immediately after the events of Star Wars-Episode II: Attack of the Clones.

$44.98Details


Star Wars 10 oz Glasses, Set of 4

1 each of Princess Leia, Darth Vader, Luke Skywalker, and Han Salo

$25.00Details

Fanboys

Get ready for the comedy adventure that's "smart, funny, and tailor-made for the inner-Jedi in all of us"

$6.49Details


Vandor 18-Ounce Ceramic Mug, Star Wars Yoda

You don't need to travel to a galaxy far, far away to find your favorite classic Star Wars characters.

$19.26Details

Star Wars: The Old Republic

Star Wars: The Old Republic is a Massively Multiplayer Online Role-playing Game

$59.95Details


Kinect Star Wars

Feel the Force as you transform yourself into a Jedi. Fully harnesses the power of the Kinect platform to deliver a natural and intuitive Star Wars experience.

$49.96Details


Kurt Adler SW6101L Star Wars Nutcracker, Storm Trooper, 11-Inch

This 11-inch nutcracker is based on a Storm Trooper from the popular Star Wars series.

$35.67Details

Lego Star Wars: The Complete Saga

Play through the events of all 6 Star Wars movies in 1 videogame for the first time ever.

$17.29Details



Stormtrooper Regrets T-Shirt

Those WERE The Droids You Were Looking For

$16.99Details

Star Wars Dinnerware Plate and Bowl - 2 Piece Set

Package includes 1 plate and 1 bowl Plate size 8 inches in diameter, bowl size is 5.75 inches in diameter.

$4.51Details


Meon Star Wars - Interactive Animation Studio

Make your own Star Wars animated signs that light up like Neon.

$11.99Details

Vandor 14 by 4 by 15-Inch Star Wars Large Recycled Shopper Tote, Multicolored

The Star Wars Large Recycled Tote is the perfect gift for any Star Wars fan.

$5.95Details


Revell Star Wars -Millennium Falcon

Perhaps the most iconic starship in the universe.

$35.61Details

Flared Star Wars Skirt

One of a kind Skirt. Flared Style. With Knit Waistband. M Waist 30-38

$25.00Details


LEGO Kids' 9002113 Star Wars Darth Vader Mini-Figure Alarm Clock

This LEGO Darth Vader clock is a must-have addition to the night table, dorm room or executive desk of any Star Wars fan.

$29.99Details

Star Wars Cupcake Stencils

Our set includes Star Wars logo, Darth Vader, Yoda and a Stormtrooper

$19.99Details


Star Wars Lightsaber USB Glow Lamp

USB Light Saber Lamp

$31.00Details

Star Wars: Episode I-VI - Movie Poster (All Characters - With Space Ships) (Size: 36 x 24) Poster Print, 34x22

Star Wars: Episode I-VI - Movie Poster (All Characters - With Space Ships) (Size: 36 x 24)

$2.82Details


Framed Star Wars YODA best quotes text print

This is a limited edition TEXT art piece. The image is made up entirely of colored text.

$19.99Details

Star Wars Clone Wars Comforter - Twin

Star Wars Clone Wars Comforter.

$34.83Details


Handmade Star Wars Chewbacca Stuffed Plush Animal

Carry Chewie where ever you go! 20 inches tall with cute button eyes and a cute button nose! Handmade out of the softest fluffiest brown fur availabel! Comes with bandolier.

$28.00Details


Uncle Milton Lightsaber Room Light

Construct your own Jedi lightsaber and mount your creation as a room light on the wall. Eight color effects let kids personalize their lightsaber, and a wireless remote control turns the light on and off.

$24.99Details


Kotobukiya Star Wars: Han Solo in Carbonite Silicon Tray

Freeze your own Han Solo! Here comes an innovative Star Wars kitchen product from a galaxy far, far away. This time around, the fun gets frosty with the Han Solo in Carbonite Silicone Tray.

$8.89Details

Boba Fett Star Wars Hat

Now you too can be digested by the Sarlac Pit Monster!

$49.99Details


© Gift Lizard 2011