×

Find gifts by describing the person you are trying to buy for. Use things like who they are (dad), their hobbies (star wars), their personality (geek, gamer).

You searched for: geekgamerfireflytravelminecraftstarcraftworld of warcraft

Reset Tags. (Click a tag to remove it. Add tags on the left side.)

World Of Warcraft Deluxe Latex Mask, Troll, Green, One Size

Sometimes I wish I could roam around the mall like it were Azeroth. Now I can with my World of Warcraft Troll Mask!

$36.99Details

Pwned Mug

PWNED.

$9.99Details


Men's Tetris Tie by Game Tie in Black

The classics of menswear and video games have finally come together to bring you this remarkable men's Tetris necktie.

$35.00Details


Echoes of War

Simply put, Echoes of War could be summed up as an album of orchestrated music from the games of Blizzard Entertainment StarCraft, Warcraft, Diablo and World of Warcraft.

$49.95Details


Nintendo Wall Graphics - Super Mario Bros

Level up your room with this Mario Themed wall graphics.

$74.95Details

Super Mario Time to Team Up 50-by-60-Inch Microraschel Throw Blanket

Mario and Luigi race to save the game surrounded by icons and characters from your favorite video game. Cuddle up in this warm throw for a long day of video game fun.

$29.99Details


The StarCraft Bible 2nd Edition: Who knew that explosions of pixels could inspire?

This is the history of StarCraft. This is the love of e-sports. This is the Bible of StarCraft.

$16.99Details


Starcraft II 2 Dog Tag USB 2gb drive James Jim Raynor

Starcraft 2 Dogtag USB Stick ensures you're the coolest kid at the lan party.

$90.00Details

Aperture Science Mug

Welcome to Aperture Laboratories, A Trusted Friend in Science!

$12.99Details


Razer Marauder StarCraft II Gaming Keyboard

The Razer Marauder StarCraft II gaming keyboard is a full featured, tournament ready keyboard with an extremely compact design.

$98.35Details

Razer Banshee StarCraft II Gaming Headset

With its circumaural design the Razer Banshee is designed for optimal sound isolation to allow you to focus completely on your game.

$100.23Details


Razer Spectre StarCraft II Gaming Mouse

Razer Spectre StarCraft II gaming mouse is a lightweight, five button mouse that is ideal for gamers that prefer precision and control for an RTS.

$63.11Details

Razer StarCraft II Zerg Edition Messenger Bag

The Starcraft II Zerg Edition Messenger Bag is designed for gamers who want to keep their gear protected, stay comfortable, and look good doing it.

$59.77Details


Wii Classic Controller Pro - Black

Created for accessibility and comfort, the Classic Controller Pro blends design elements from game systems such as the NES, Super NES, and Nintendo 64 providing seamless play control for a wide range of games.

$19.99Details

Ten One Design Fling Game Controller - Ninja

Fling is a tactile game controller for iPad.

$9.50Details


Pleo Dinosaur - A UGOBE Life Form

Pleo looks, moves, sounds and behaves like a living creature. Fully aware and cognitive, he explores his environment and interacts with people, accessories and other UGOBE dinosaurs.

$508.08Details

StarCraft II: Heart of the Swarm (Pre-Order)

Heart of the Swarm expansion for Starcraft 2

$59.99Details


Halo 3, Master Chief Costume, Adult Standard

Quilted jumpsuit with EVA armor, two-piece deluxe helmet, gauntlets and boot tops.

$580.46Details


Multi Green Laser 5mw

As seen on ghost hunters. You know it is legit now!

$11.75Details


World of Warcraft® Pet: Pandaren Monk

World of Warcraft® Pet: Pandaren Monk

$5.00Details

Firefly: Still Flying: A Celebration of Joss Whedon's Acclaimed TV Series

Still Flying is a brand new celebration of all aspects of the show, featuring a wealth of rare and previously unpublished images including storyboards, production design art and candid behind the scenes photos, memories from the cast

$13.57Details


Minecraft Diamond Earrings

Advertise your love for Minecraft with these rare gems! Here is a pair of gorgeous diamond earrings, straight from the depths of my private mine. Diamonds *are* a miner's best friend.

$10.00Details

Infrared Mini Radio Controlled Marine Cobra Helicopter Gyro

Mini remote control helicopter. USB charger.

$24.94Details


World of Warcraft Carrot on a Stick Keychain

3% Speed Increase with the purchase of this keychain.

$6.95Details

All My Friends Are Dead

All My Friends Are Dead presents a delightful primer for laughing at the inevitable.

$9.95Details


World of Warcraft Mount: Celestial Steed

Freshly born from the Twisting Nether, the Celestial Steed flying mount lets you travel in style astride wings of pure elemental stardust.

$10.00Details

Joss Whedon's Serenity Ornament Inara's Shuttle

Fans of Firefly will be familiar with the shuttle that Inara Serra, well-respected companion, rents from Serenity for her periods of separation from the ragtag crew.

$19.95Details


3D Pig from Minecraft

Oink! Oink!

$20.00Details

World of Warcraft Orgrimmar Mug

Massive stoneware mugs holds 18oz of you favorite hot beverage. Handcrafted from superior quality fine-grain stoneware.

$19.99Details


Star Wars Interactive R2D2

Dancing to Cantina Music, bringing you drinks and guarding your precious stuff. What more could you ask for from the most faithful robot in the galaxy?

$199.99Details

SteelSeries World of Warcraft Cataclysm MMO Gaming Mouse

The SteelSeries World of Warcraft: Cataclysm MMO Gaming Mouse is fully scalable to meet and exceed the requirements of even the most demanding World of Warcraft gamer.

$93.90Details


Serenity - Firefly Metal Keychain

Serenity is about freedom. Serenity is about going where you want, when you want, with nothing in The Verse to stop you.

$22.98Details


Minecraft Diamond Tool/Weapon Magnet Set

Each magnet has at least one strong round magnet or bar magnet so they're not only fun but functional. See my shop for other Minecraft sets, including this one in iron and gold.

$10.00Details

World of Warcraft RAWGRLRLRLRRLGLRL

Murlocs are drunkards.

$99.94Details


Swinging Sticks Kinetic Energy Sculpture

The Swinging Sticks Kinetic Energy Sculpture is a high end, museum quality moving display that is ideal for offices, lobbies, waiting rooms, and conference rooms.

$229.99Details

SteelSeries Shift Gaming Keyboard-World of Warcraft Cataclysm Edition

The SteelSeries Shift World of Warcraft: Cataclysm Edition Bundle presents gamers with predefined game mods and an intuitive layout of the most common commands, actions and emotes.

$99.99Details


Firefly Inspired - Leaf on the Wind, Watch How I Soar Necklace

'I am a leaf on the wind. Watch how I soar.' Only a Firefly fan would appreciate the tragic beauty of Wash's last line.

$17.95Details

Sub Zero Macbook Decal Mac Apple skin sticker

Make your Mac Book go Sub-Zero in coolness.

$15.99Details


Minecraft University Hoodie

Ad Gloriam et Porcos (For pigs and glory!)

$59.99Details

Blizzard For the Horde World of Warcraft Coffee Mug

FOR THE HORDE! After this cup...

$29.99Details


8 Bit Tie

A reminder of better days.

$14.99Details

SteelSeries QcK World of Warcraft Cataclysm Gaming Mouse Pad-Deathwing Edition

The SteelSeries QcK mousepad provides users with a precise and consistent glide through the combination of this high quality cloth material and an optimized textured surface.

$14.99Details


Serenity PVC Set

You get Mal, River, and Jayne in this set of PVC figures based on Joss Whedon's blockbuster film Serenity.

$19.99Details

Stryker the Smoking Dragon Sculptural Incense Box

A peaceful house starts with dragons and incense.

$24.95Details


Firefly - The Complete Series

One of the greatest shows to ever be cancelled.

$24.99Details

World of Warcraft Undercity Mug

This large World of Warcraft Undercity Mug means fewer refills and more time for gaming!

$26.98Details


USBCELL AA Rechargable Battery

Can't find your charger? USBCELL AA Rechargeable Batteries work just like normal rechargeable batteries--but simply pop off the lid to recharge by any powered USB Port.

$19.95Details

Wrath of the Lich King (Main Title) (from World of Warcraft) Sheet

collectible sheet music from the soundtrack of Blizzard Entertainments World of Warcraft

$3.86Details





Serenity (Widescreen Edition)

The Firefly Movie. Picks up where Firefly left off, but doesn't alienate people who have never seen the TV show.

$9.99Details


Zen Magnets - Gift and Retail Packed Zen Set

Zen Magnets. These super powerful and tiny magnets are a lot of fun for kids and adults.

$59.95Details


Bronze Firefly Wash quote bracelet

Firefly Fans and Family. I have made a bronze and leather appx 1 inch cuff with the I am a leaf on the wind leather name plate.

$35.00Details

Portable Amp For Iphone Horn Stand White

Turn up the sound with science (and not your battery)

$24.99Details


Done The Impossible: The Fans' Tale of Firefly & Serenity

Adam Baldwin hosts the telling of this vivid Browncoat story that features interviews with Joss Whedon, creator of Firefly and Serenity, the cast, crew, and most important, the fans themselves.

$12.95Details


Handcrafted Figured Mahogany Case for iPhone 4/4S

Protect your phone with classic style.

$69.95Details

Bamboo Wirelesskeyboard & Mouse

Environmentally friendly keyboard and mouse combo

$142.09Details


Firefly/Serenity Jayne Hat

This awesomely cunning hat, in the style of our favorite PR specialist from Firefly - Jayne Cobb, is made of SUPER soft acrylic in colors that perfectly match the original from the show!

$35.00Details

Minecraft Creeper Anatomy T-Shirt

The Creeper (Creepus explodus) is an all-terrain combustible terror of destruction, indigenous to dark caves found deep beneath the earths crust, and luxurious neighborhoods with glass houses and nice fancy everythings.

$19.99Details


MATH CLASS Wall Clock mathematics teacher classroom gift

I probably will never know what time it is again.

$22.99Details

World of Warcraft WOW ALLIANCE Crest Leather WALLET

Licensed World of Warcraft Alliance Crest Leather Wallet Brown Leather Wallet has 6 compartments

$29.99Details


Bath Tissue Tyrant: Commode Dragon

Some dragons are helpful. Rest peacefully knowing this dragon is guarding the most important thing in the room.

$34.95Details

Serenity Define Interesting T-Shirt

Define Interesting. 1. Capable of holding one's attention. 2. Arousing a feeling of interest. 3. Oh God, oh God, we're all going to die.

$21.88Details


Minecraft Confused Shirt

We presume that to a denizen of Minecraft spheres would be sort of like what non-Euclidean geometry is to us.

$19.99Details

Tailgate Folding Wooden Picnic Table

Have a picnic anywhere with the comfort of your own personal picnic table.

$134.99Details



LEEROY JENKINS!!! Coffee Mug

LEEEEEEEEERRRRROYYYYYYYYYYYYYY

$15.95Details

Minecraft Creeper T-Shirt

Embrace your inner Creeper!

$19.99Details


Exhaust Powered Car Jack

Jack your car up with the exhaust it's generating, simple and elegant car repair.

$224.98Details

Upper Deck World of Warcraft? Miniatures Core Set Starter

Hold the power of Azeroth in the palm of your hand! Let the heroes of Warcraft enter your world as Upper Deck Entertainment introduces the World of Warcraft? Miniatures Game!

$2.99Details


World of Warcraft Frostmourne Latex Sword

Whosoever takes up this blade shall wield power eternal. Just as the blade rends flesh, so must power scar the spirit.

$144.99Details


Eat Sleep Minecraft T-Shirt

Eat, Sleep Minecraft

$23.52Details

Mario Bros.: Koopa Shell Plush and Backpack

You never know when you need a turtle shell.

$39.95Details


Upper Deck World of Warcraft Heroes of Azeroth Starter Deck

Horns blaze across the Eastern Kingdoms, calling the Alliance to arms. The drums of Durotar hasten the Horde to prepare for the looming conflict ahead. Glorious battles, prized treasures and dominion over all of Azeroth are on the table!

$11.90Details

Jedi Dressing Gowns - Star Wars Bath Robes

Those aren't the droids you're looking for.

$88.44Details


Firefly Necklace- You can't take the sky from me

Can't take the sky from me necklace

$25.00Details

WORLD OF WARCRAFT HORDE 1/1/2 " Metal Logo KEYCHAIN

World of Warcraft Horde Metal Logo Keychain

$11.95Details



Wookiee Cookies: A Star Wars Cookbook

Tusken Raider Taters, Yoda Soda, C-3PO Pancakes... mmmm sounds delicious!

$18.99Details


Serenity Firefly Crime To Be Done Mal T-shirt

Got us some crime to be done.

$17.95Details

WORLD OF WARCRAFT ALLIANCE 1/1/2 " Metal Logo KEYCHAIN

World of Warcraft Alliance Metal Logo Keychain

$12.99Details


Sir Creeper of Minecraftia

Sir Creeper is a lover of all things expensive, and your newly acquired diamond is looking really good to him right now.

$24.54Details

Sea to Summit Pocket Shower

Bring an 8 minute shower anywhere you go. Also works as a regular dry sack.

$24.21Details


World of Warcraft - Behind-the-Scenes DVD

From the best selling massively multiplayer online role-playing game, World of Warcraft, comes this deluxe DVD packed with over an hour of exciting behind-the-scenes content.

$29.95Details

Peekaru Original Fleece Baby Carrier Cover Medium - Black

Share the warmth with your baby or toddler. The Peekaru Original is an environmentally friendly fleece vest that fits over you and your baby, keeping you both warm without giving up the comfort of your favorite baby carrier.

$79.95Details


Firefly Logo T-Shirt

We like Firefly. You like Firefly. This here's a Firefly all official-like t-shirt.

$17.99Details


Don't Fear the Creeper (Sticker)

There's nothing to fear, all he has is an explosive personality!

$2.40Details

Sport-Brella Umbrella Chair, Blue

Tired of all the shady spots being taken? Bring your own chair and shade together!

$39.99Details


Race to World First

Race to World First documents the struggles, triumphs, and frustrations of Blood Legion as it prepares to beat the newest bosses released in World of Warcraft.

$14.99Details

Kymera Magic Wand Remote Control

Imagine walking into the room with your children and their Muggle friends watching TV, whipping out a magic wand from under your jacket and changing the channel in a flash.

$89.99Details



Skull & Pickaxes (Sticker)

The traditional Skull & Crossbones with an added Minecraft twist!

$2.40Details

Star Wars Storm Trooper USB Drive 4GB

Storm Trooper USB stick.

$34.99Details


Clear Blue Hawaii Molokini 2 - Person Kayak

Transparent Molokini Kayak. Discover. Explore. See. Witness fascinating lake or sea life through the sleek transparent hull. This is a great investment whether your goal is serious research or a child's voyage of discovery.

$2,243.17Details



Garden Zombie

There's A Zombie On Your Lawn! Nobody was quite sure what caused it. An alien pathogen riding the tail of Halley's Comet? Some government "rage" virus? Radiation from a downed satellite?

$89.99Details


About Face 3: The Essentials of Interaction Design

This completely updated volume presents the effective and practical tools you need to design great desktop applications, Web 2.0 sites, and mobile devices. This book will teach you the principles of good product behavior.

$45.00Details

World of Warcraft - Wrath of the Lich King - 11x17 Poster

World of Warcraft - Wrath of the Lich King - 11x17 Poster

$4.99Details


Firefly Fruity Oaty Bar Not Mandatory T-shirt XL

This cool Serenity t-shirt features the Fruity Oaty Bar ad in a high quality, vintage look print.

$22.95Details

Creeper Mousepad

You'll receive one cloth topped mousepad that is backed with non-slip, non-marking rubber.

$12.00Details


Silver Robot 8GB Flash Drive

When it comes to file storage, you want something as reliable as your favorite lovable robot.

$44.99Details

SteelSeries QcK World of Warcraft Cataclysm Gaming Mouse Pad-Worgen Edition

SteelSeries QcK has been tested by professional gamers around the world and has been used to win more tournaments and competitions than any other mousepad across the globe.

$14.12Details


Don't Make Me Think: A Common Sense Approach to Web Usability, 2nd Edition

100,000 copies sold. If you do anything web related, this book is a must read.

$40.00Details

World of Warcraft - Elf Warriors - 11x17 Poster

World of Warcraft - Elf Warriors - 11x17 Poster

$7.99Details


Minecraft Diamond Ring

The ring is adjustable, and the figure is made from Polymer clay. It is painted with acrylic paint and finished with Min-Wax polycrylic to seal and protect it.

$10.00Details


Think Geek Star Trek Enterprise Pizza Cutter

Boldly go where no pizza has gone before with Think Geek's Star Trek Pizza Cutter.

$24.99Details


The Design of Everyday Things

Anyone who designs anything to be used by humans--from physical objects to computer programs to conceptual tools--must read this book, and it is an equally tremendous read for anyone who has to use anything created by another human.

$15.95Details


Minecraft inspired Grass Cube Tissue Box Cover

Save your desk or nightstand from those ugly cardboard tissue boxes!

$18.00Details

Iron Man Mark II 12 Inch Deluxe Figure

This is a must for any collector Iron Man in this full body titanium color suit just like thr prototype in the movie.

$999.99Details


Electronic Guitar Shirt

You air guitar getting old? Step up your game with this rockstar guitar tshirt with built in mini amp.

$19.99Details


Firefly Light Tile Pendant FF4

Firefly Light Scrabble Tile Pendant (Pendant Only)

$8.00Details


Priceless MLG

For the things money can't buy.

$25.00Details

Starcraft II: Wings of Liberty

Starcraft 2: Wings of Liberty (Game)

$49.99Details


Gosu T-Shirt

Remind everyone.

$22.50Details

Terran Dog Tag

Lovely Starcraft II Terran Dog Tag Necklace

$55.00Details


Gimme Your Ladder Points T-Shirt

Beating Up Nerds Since Beta

$21.50Details

Zerg Dog Tag

StarCraft 2 ZERG Dog Tag Necklace

$55.00Details


More GG, More Skill T-Shirt

White-Ra's Mantra

$22.50Details

Protoss Dog Tag

StarCraft 2 Protoss Dog Tag Necklace

$55.00Details


Top 3 Control T-Shirt

Huk, ?, and You!

$22.50Details

Revolution Overdrive: Songs of Liberty Vinyl

This StarCraft II Collectors Vinyl features never before released music from Joeyray's Bar. Printed on a dual sided picture disk, this high quality collector's item is ready for framing or playing on that old record player.

$25.00Details


Release The Gracken T-Shirt

If you can't beat'em, you might as well buy the t-shirt. Featuring IdrA.

$24.95Details

World of Warcraft - Wizard - Burning Crusade 11x17 Poster

World of Warcraft - Wizard - Burning Crusade 11x17 Poster

$7.99Details


Evil Geniuses Team Jersey

Official EG Team Jersey

$24.95Details

WORLD OF WARCRAFT CATACLYSM Poster Print, 24x36 Poster Print, 24x36

WORLD OF WARCRAFT CATACLYSM Poster Print, 24x36

$0.01Details


Larva Inject T-Shirt

In order to protect your children from extremely deadly and contagious 2 barracks rushes, make sure they're up to date with their larva injects.

$19.99Details

e-Sports Shirt

Sure I can't beat you in one-on-one basketball, but how's your macro?

$19.99Details


StarCraft II Protoss Vintage Logo T-Shirt

Show off Your 4 Gate Pride.

$19.99Details

NaNiWa T-Shirt

It is simple.

$24.95Details


StarCraft II Terran Vintage Logo T-Shirt

You're Terran Up My Heart

$19.99Details

Prime Winter Uniform

Dress like Marine King.

$80.00Details


StarCraft II Diamond League T-Shirt

Almost masters, I swear!

$19.99Details

Prime Padded Jacket Uniform

Stylish winter uniform from Prime team.

$200.00Details


StarCraft II Logo Keychain

Improve your Key APM

$7.99Details

I Heart eSports Sticker Bundle

Collection of 4 High-quality vinyl stickers

$7.70Details


SteelSeries QcK Starcraft II Gaming Mouse Pad-Tychus Findlay Edition

Made of a high-quality cloth material with an optimized textured surface, the SteelSeries QcK Limited Edition (StarCraft II Tychus Findlay), provides players with both a smooth and consistent gliding surface.

$14.99Details


Team Liquid poster

TL Triple Horse Poster

$12.95Details

Starcraft II Wings of Liberty Button Badge 4-Pack

Starcraft II Wings of Liberty fans will love this set featuring logos from Zerg, Protoss, Terran, and Starcraft II.

$7.99Details



StarCraft Protoss Ready to Serve T-Shirt

Zealot is Ready to Serve

$19.99Details

Starcraft II Mega Bloks BlizzCon 2011 Exclusive Limited Edition Set Battlecruiser

Blizzcon exclusive 1,736 piece Battlecruiser preview set limited edition of 3,000 worldwide.

$299.99Details



Probes and Pylons T-Shirt

As seen on Day 9

$24.54Details

Starcraft II 2 Collectors Edition Art book

Starcraft 2 limited edition Art book! This was only available in the SOLD out Collectors Edition! This is for the Limited Edition Art book only!

$50.87Details


men's zergling tshirt

lings like music too

$20.00Details

StarCraft Widescreen DVD Movie Special Limited Edition

All the Cut-Scenes from the game on DVD

$22.97Details


Team Dignitas Hoodie

Team Dignitas 2011 Hoodie's. (Price in Euros)

$48.95Details

Tastosis T-Shirt

The Casting Archon

$25.00Details


I Love Starcraft T-Shirt

I Love Starcraft from Blizzard

$22.00Details

World of Warcraft: Arthas: Rise of the Lich King

the true story behind one of the Warcraft universe's most terrifying villains, Arthas the Lich King.

$8.99Details


World of Warcraft Quest Giver (!) Flexfit Hat

I've got a quest for you...

$22.99Details

SC 2 Gaming Gloves

Warm hands means higher APMs

$17.00Details


World of Warcraft: Thrall: Twilight of the Aspects

Before this apocalyptic vision comes to pass, Thrall must purge his own doubts in order to discover his purpose in the world and aid Azeroth's dragonflights as they face the Twilight of the Aspects.

$26.00Details

Sphere Pen Camera - Hidden Video Spy Pen

1.5 hours of high quality video stored on 4GB memory card.

$99.99Details


+15 Frost Resist Beanie

Whether staving off a Shaman's frost shock or simply looking to not freeze your ass off, this stylish beanie will have your gaming buddies jealousy levels reach new heights.

$15.95Details

World of Warcraft: The Shattering: Book One of Cataclysm

In her NY Times bestseller, THE SHATTERING, now in mass market paperback, Christie Golden delivers a sensational tie-in to the newest World of Warcraft game expansion.

$8.99Details


Reamde: A Novel

Reamde is a swift-paced thriller that traverses worlds virtual and real. Filled with unexpected twists and turns in which unforgettable villains and unlikely heroes.

$18.99Details

Epic Ganking T-Shirt

Show off your ganking skills

$19.95Details


World of Warcraft: Rise of the Horde (No. 4)

The demon-lord Kil'jaeden set in motion a dark chain of events that would succeed not only in eradicating the draenei, but forging the orc clans into an single, unstoppable juggernaut of hatred and destruction.

$7.99Details


Orc Army T Shirt

For the Horde!

$19.95Details

World of Warcraft: Cataclysm

The Actual Game

$24.98Details


Desktop Warfare Kits (Catapult)

Your own personal catapult.

$25.99Details

Thermos Stainless King SK1005MB4 16-Ounce Leak-Proof Travel Mug, Midnight Blue

The ultra-durable, leak-proof Thermos Stainless King travel mug features an unbreakable stainless steel interior and exterior, making it a great companion for use in rough-and-tumble situations such as construction sites, delivery work, and more.

$19.43Details


Kate Spade iPhone 4 Tropical

This fun striped pattern is done in bold shades of lavender, yellow-gold,blue, fuschia, pink and lime.

$25.00Details


Pelican 1170 Carrying Case for Multi-Purpose - Black

Hand-held electronics protection solution. Watertight, crushproof, and dust proof. Easy open Double Throw latches. Open cell core with solid wall design - strong, light . O-ring seal. Automatic Pressure Equalization Valve. Pick N Pluck with convoluted li

$34.24Details

SteelSeries QcK Starcraft II Gaming Mouse Pad-Kerrigan Vs. Zeratul Edition

The SteelSeries QcK Kerrigan vs. Zeratul Edition mousepad is made of a high quality cloth material, providing a precise and consistent glide.

$14.12Details



StarCraft II 2012 Wall Calendar

Players will love this exciting calendar with its vivid images of their favorite heroes as they struggle for survival on the edge of the galaxy. Includes removable stickers to mark your keyboard with memorable plays!

$10.19Details



Starcraft II: Heaven's Devils

For the first time ever, StarCraft enthusiasts will learn the origins of the enduring friendship between the young upstart Jim Raynor and the streetwise soldier Tychus Findlay.

$10.00Details

World of Warcraft

The Actual Game

$17.40Details


Doctor Who 11 Doctors 5" Action Figure Collector Set

This boxed set features 5 inch figures of the eleven men to portray the Doctor in the BBC series, with new costumes and new sculpts.

$99.99Details

Minecraft Note Cube

Leaves no cobblestone residue once fully mined

$14.95Details


Starcraft II: Devils' Due

Devils' Due recounts an unforgettable period of Jim Raynor's life as he descends into the Koprulu sector's criminal underworld alongside the street-savvy Findlay.

$17.16Details


Gerber 31-000751 Bear Grylls Survival Series Ultimate Knife, Serrated Edge

Intricately designed by Gerber and Bear, it's loaded with innovations that won't be found in any other fixed blade knife. Like everything in the Survival Series, it also includes Bear's Priorities of Survival pocket guide.

$42.13Details

Minecraft Sheet Magnets

80 1" square blocks on each sheet (2 sheets)

$21.53Details



Transformer USB Flash Memory Drive 4GB

This USB drive transforms from Leopard to USB stick in seconds.

$9.80Details

Minecraft Drop it Creep Premium Tee S

A Creeper bounces his way up to an unsuspecting clerk, Give me all your money, bookworm, or I blow up your brainssssSSSsss!

$21.99Details



Minecraft Foam Pickaxe

The Minecraft Foam Pickaxe is made from sturdy EVA foam, which means that unlike the stone pickaxe in the game, the Minecraft Foam Pickaxe will withstand far more than 132 uses.

$49.99Details


Men's Play Money Tie by Fun Ties in Black

This unique novelty tie features colorful play money on a durable black polyester fabric. This necktie is worth a million dollars, well a million dollars in play money.

$25.00Details


World of Warcraft Orc Overhead Latex Mask

This is an officially licensed World of Warcraft mask.

$33.44Details

Mindflex Duel Game

Mindflex Duel is the ultimate head-to-head brain game challenge

$74.99Details


Shower Shock Caffeinated Soap

the original and world's first caffeinated soap from ThinkGeek. When you think about it, ShowerShock is the ultimate clean buzz ;)

$6.99Details


Learning Resources Zoomy Handheld Digital Microscope

Amazing all-in-one digital microscope takes scientific inquiry to a new level - yet is easy for even a young child to use.

$59.95Details


LEGO Star Wars Ultimate Collector's Millennium Falcon

Han Solo's famous starship is crafted from over 5,000 Lego pieces.

$499.99Details


Something to Read on the Plane

A delightfully light-hearted variety of stories, articles, limericks, and even a quiz to see how good a passenger you are.

$0.99Details


Iron Man 2 Macbook Decal Mac Apple skin sticker

A wise man once asked, Is it better to be feared or respected? I say, is it too much to ask for both?

$15.99Details


Swiss+Tech UKCSB-1 Utili-Key 6-in-1 KeyChain MultiTool

The lightest and most compact multi-use tool ever developed.

$7.50Details


Kurt S. Adler 10-Light Star Wars R2D2 Light Set

This novelty light set features 10 R2D2 lights with 30-inch lead wire and 12-inch spacing.

$30.00Details


Lightphoria 10,000 lux SAD Light Therapy Pad (Seasonal Affective Disorder) Sunlight Simulator. 2011 model (v2.1)

Bright light has been used for over a decade to alleviate symptoms associated with Seasonal Affective Disorder (SAD), jetlag, shift work fatigue, insomnia, seasonal change and more.

$99.99Details




Levitron AG Anti-Gravity Globe

Observe Earth levitate in space - only touching air!

$79.99Details


(4gb MicroSD Bundle) US Mint 1/2 Dollar - Micro SD Card Covert Coin - Secret Compartment

Spy coin helps you turn every day objects into a secret compartment.

$34.99Details


World of Warcraft Horde Polo

You haven't heard of that new brand, Horde?

$31.99Details

Team Liquid T-shirt

TL Horse Logo Shirt - Steel

$21.95Details


World of Warcraft: Wolfheart

In the wake of the Cataclysm, conflict has engulfed every corner of Azeroth. Hungering for more resources amid the turmoil, the Horde has pressed into Ashenvale to feed its burgeoning war machine.

$16.76Details


River Tam and the Fireflies (Poster)

Join the crew of this firefly class transport ship as they aim to misbehave with hit songs such as "I Swallowed A Bug", "Nothin' Twixt My Nethers", and their new, hit single "Miranda".

$20.00Details

Sci Fi Reference t-shirt

This is our remastered Sci-Fi movies reference t-shirt.

$19.95Details


Firefly Poster TV 11x17 Nathan Fillion Morena Baccarin Adam Baldwin Ron Glass

Firefly Reproduction Poster Print Style A 11 x 17 Inches -28cm x 44cm

$19.99Details

Star Wars: The Old Republic

Star Wars: The Old Republic is a Massively Multiplayer Online Role-playing Game

$59.95Details


Map of the Verse (Rolled)

Map of the Verse (Poster)

$41.50Details

Kinect Star Wars

Feel the Force as you transform yourself into a Jedi. Fully harnesses the power of the Kinect platform to deliver a natural and intuitive Star Wars experience.

$49.96Details


DiY Serenity Firefly Small Tote Bag Malcolm Reynolds

This is a brand new lightweight small purple tote bag.

$12.00Details

LEGO Kids' 9002137 Star Wars Storm Trooper Mini-Figure Alarm Clock

A superb character mini figure style clock from the masters at Lego, featuring Alarm and a Snooze Button!

$23.99Details


(24x36) Serenity Movie (Firefly Group) Poster Print

(24x36) Serenity Movie (Firefly Group) Poster Print

$9.80Details

Britax Frontier 85 Combination Booster Car Seat, Rushmore

The new Britax frontier 85 combination harness 2 booster boasts best in class forward-facing five-point harnessed weight capacity up to 85 pounds with an industry-leading 20" shoulder harness height.

$212.49Details


Firefly Poster TV D 11x17 Nathan Fillion Morena Baccarin Adam Baldwin Ron Glass

Firefly reproduction Approx. Size: 11 x 17 Inches - 28cm x 44cm Style D mini poster print

$24.99Details

Camelbak M.U.L.E. 100 oz Hydration Pack, Chili Pepper/Charcoal

The M.U.L.E. NV from Camelbak is a narrow-gauge pack for 3+ hours of all-terrain adventures in any weather.

$69.98Details


Firefly Serenity 36 Inch Full Afterburner Fiberglass Model Built, Finished, Painted, and Lighted

Full Afterburner 36 inch fiberglass Firefly model ready for display.

$599.00Details

Eagles Nest Outfitters DoubleNest Hammock (Orange/Grey)

The DoubleNest seats more than one person comfortably and is essential for family adventures. The DoubleNest still packs down to the size of a grapefruit, so there is no excuse to be without your ENO hammock.

$64.95Details


Radica 20Q Artificial Intelligence Game - Colors may vary since the item may come in 3 different colors

I didn't believe it would work, but I tested the online version and it got 'Satellite' correct. Impressed.

$19.99Details


Joss Whedon's Firefly Serenity 11x17 Original Promotional Movie Poster

Promotional Serenity Movie poster. These were given to theaters and also sci fi convention promotors to hand out to fans. Along with everything Serenity, they have become highly collectible.

$9.95Details


Serenity Atlas of the Verse, Volume 1

The Atlas of The Verse is loaded with beautiful art, incredible renderings and detailed diagrams that really help bring The Verse to life.

$42.42Details

Marines T-Shirt

Marines Marines Marines

$17.00Details



Audio-Technica ATH-M50 Professional Studio Monitor Headphones

One of the most popular headphone sets in existence. Designed for DJs/Producers, they are fantastic for anyone.

$159.00Details

Fasta Pasta The Microwave Cooker

No waiting for a big pot of water to boil. Cook pasta to al dente perfection in the microwave! Saves time, energy and water.

$8.99Details


iHome iHM60LT Rechargeable Mini Speaker (Blue Translucent)

The iHM60 is an amazing approach to audio that offers size defying sound. Speaker connects to a computer or other USB power source via the included USB cable to recharge the internal lithium ion battery.

$19.99Details

Quantum Mechanix Serenity: Big Damn Heroes: River Tam Maquette

Serenity's psychotic killing machine River Tam

$49.98Details


Satechi CR -3600 car holder mount for iPhone 4S, 4, 3G & 3GS, BlackBerry Torch, HTC EVO, DROID, Samsung EPIC on Windshield and Dashboard

Using a smartphone as a GPS? Mount it in your car properly just like a traditional GPS.

$29.99Details

Firefly Inspired Tshirt - Also, I Can Kill You with My Brain

A fantastic printed t-shirt inspired by the Firefly and Serenity. (Price GBP)

$9.99Details


4 Gate Shirt

Price in Euros

$15.00Details

Firefly (Original Television Soundtrack)

Composer Greg Edmonson created a flavorful, guitar-based score for the adventures of the crew of Serenity. CD features exclusive bonus tracks.

$14.99Details


3 Rax Shirt

Price in Euros

$15.00Details

Serenity

This action/adventure/Sci-Fi/western features an eclectic score by composer David Newman.

$17.04Details


6 Pool T-Shirt

Price in Euros

$15.00Details


Bananagrams

The Anagram game that will drive you bananas. The award-winning word game that needs no pencil, paper, or board. Fast and fun.

$14.95Details

Captain Mal's Pistol from Firefly - Resin cast kit - Hand Painted

Offered here is a premade cast resin kit of Jayne's Custom Lemat "Boo" from Firefly and Serenity fame.

$249.99Details


Weber 386002 Q 100 Portable Propane Gas Grill

The grill ignites at the push of a button for reliable lighting, and an infinitely adjustable burner valve with a high-quality regulator makes it easy to control the heat.

$134.24Details


Diablo III

Shut up and take my money Blizzard.

$59.99Details

(12x16) Serenity Movie Firefly Blueprints Reference Pack Spiral Bound Book

Blueprints in case you ever want to make your own Serenity

$42.93Details


Star Wars: The Complete Saga (Episodes I-VI) [Blu-ray]

The Ultimate Sci-Fi Series on Blu-Ray.

$86.99Details

© Gift Lizard 2011