×

Find gifts by describing the person you are trying to buy for. Use things like who they are (dad), their hobbies (star wars), their personality (geek, gamer).

You searched for: geekbedroommusicmomdrinkingartistwaterbathroomstarcraftbeerimagespartygirlfriendkitchen

Reset Tags. (Click a tag to remove it. Add tags on the left side.)

Vinturi Essential White Wine Aerator

Specially designed to aerate white wine and produce better bouquet, enhanced flavors and smoother finish

$42.89Details

1888 Mills Luxury Cotton Made in Africa Bath Towel, White

Super soft bath towel from African cotton with sales contributing to reducing poverty in Africa.

$16.03Details


PUR 18 Cup Dispenser with One Pitcher Filter DS-1800Z

Keep your water clear of chemicals and odors with this dispenser from PUR. Its advanced filtration system reduces more contaminants (lead, copper, zinc, etc.) than any other pour-through filter.

$27.81Details


Sony ICFS79W AM/FM/Weather Band Digital Tuner Shower Radio (White)

Listen to your favorite shows while you shower.

$52.58Details

Adagio Teas 16-Ounce Ingenuitea Teapot

Great for the office or when traveling, this innovative teapot releases infused tea into a drinking cup. When tea is ready, simply place it atop the cup, causing a valve at the bottom to release and crystal-clear tea to flow down.

$17.45Details


Soft Heat Micro-Plush Top Low-Voltage Electric Heated Twin Mattress Pad, White

"Amazing" is the best word to describe this ultra-plush pad with its incredibly soft, supportive and luxurious Micro-Velour fabric top.

$65.99Details

Flip UltraHD Video Camera

Taking HD video has never been so easy or portable! Flip HD lets you capture every moment with dazzling quality without breaking the bank.

$129.00Details


Bodum Brazil 8 cup French Press Coffee Maker, 34 oz, Black

Bodum Brazil offers a classic take on modern, functional design that will never go out of style.

$16.99Details

PostSecret: Extraordinary Confessions from Ordinary Lives

A global phenomenon, exposing our individual aspirations, fantasies, and frailties -- our common humanity.

$17.68Details


Electronic Guitar Shirt

You air guitar getting old? Step up your game with this rockstar guitar tshirt with built in mini amp.

$19.99Details

Boyfriend Pillow

Want to cuddle but nobody is around? The boyfriend pillow will hold you, every night, all night.

$60.00Details


Fred and Friends Hopside Down Glass

Hopside Down, is that pun not enough of a description?

$20.00Details

Kikkerland Skull Shot Glasses, Set of 4

Skull Shot Glasses, do I really need to write more than that?

$11.99Details


The Hungover Cookbook

Learn to cure your hangover with these delicious recipes!

$10.00Details


Metal Jewelry Stand Tree with an Antique Silver & Gold Finish

Iron Jewelry Tree Stand Unique tree design with leaves and branches Done in an antique silver/gold finish Works great for necklaces and bracelets and has 40 hanging positions

$23.99Details

Tasting Beer: An Insider's Guide to the World's Greatest Drink

Everything you ever wanted to know about beer!

$16.95Details


Lush Life Party Ice Luge

Let the fun begin when your pour your favorite drink down the luge.

$22.50Details

Hops Holster 12 Can Ammo Pack

When you're ready to wage war on thirst (and possibly sobriety) the Hops Holster 12 Can Ammo Pack is the only beer holder gear you need.

$39.95Details


IMCG Fridge Monkey - Charcoal

Bottles, Cans and drinks in general shouldn't fall out of the fridge ever again.

$7.99Details

Tea Sub - Yellow Submarine Tea Infuser

We all live in a yellow submarine, a yellow submarine,a yellow subm...

$10.81Details


SHOT GLASS ICE MOLD (13PC. SET)

Take the chill off your next soiree when you serve guests a shot in an edible frozen glass.

$14.99Details

Das Boot

Das Boot.

$34.99Details


12 Gauge Shot Glass

Fire off a few rounds with our set of 12 Gauge Shot Glasses.

$17.95Details

Mr. Beer Premium Gold Edition Home Brew Kit

A great starting point for a beginning and intermediate brewers, it includes two of Mr. Beer's most popular beer mixes as well as everything needed to both brew and bottle your first 2 batches of top-quality beer.

$59.99Details


Fred Cool Jazz Ice Cube Tray

It is time to kick back and chill and here is a cool way to do it! Drop one of these groovy guitars into your drink, and give it a stir. Just the thing for jazzing up your favorite beverage.

$7.99Details

Numi Organic Tea Flowering Gift Set in Handcrafted Mahogany Bamboo Chest: Glass Teapot & 6 Flowering Tea Blossoms

Packaged in an exotic hand-made dark mahogany bamboo case, this Flowering Gift Set is filled with six bouquets of tea leaves that blossom into a myriad of flavors from sweet and subtle to rich and bold.

$21.75Details


Sea Kelp / Moss with Chamomile Herb and Cocoa Butter Soap

The seaside scent in this natural beauty facial and body soap coupled with the invigorating hint of cocoa butter will make you feel like you are relaxing by the ocean.

$9.50Details

Silk Nightgown and Robe Set - Royal Peacocks

The robe, on the back, features a pair of majestic peacocks perched on a tree brimming with deep red autumn colors. The painting flows into the front of the robe as well as the gown.

$159.00Details


MIU France Zinc Alloy Connoisseur Corkscrew Wine Opener

The next best thing to an in-house sommelier, this professional-quality wine opener offers the same impressive performance and stylish design as corkscrews that cost far more.

$20.99Details

Altec Lansing inMotion MIX iMT800 Portable Digital Boom Box for iPhone and iPod

Altec Lansing iMT800 "MIX" Get ready to Rock the house! Versatile iPhone/ iPod docking with three separate inputs and FM radio, LCD display

$299.95Details


Aurorae Classic Yoga Mats

Ultra Thick, Extra Long with Rising Moon Focal point Icon, Illuminating Colors, Eco Safe, Free from Phthalates and Latex

$34.95Details

Acupressure Mat | Acupuncture Mat for Back Pain Relief | (nail bed or spike mat) (Green)

The Nayoya Mat uses the benefits of acupuncture to help the body repair itself, and heal itself from all kinds of stress such as back pain, fatigue, insomnia, high blood pressure, and muscular soreness.

$49.99Details


iHome iHM60LT Rechargeable Mini Speaker (Blue Translucent)

The iHM60 is an amazing approach to audio that offers size defying sound. Speaker connects to a computer or other USB power source via the included USB cable to recharge the internal lithium ion battery.

$19.99Details

Waterfi Waterproof iPod Shuffle 4th Generation 2GB - Underwater MP3 Player for Swimming & Water Sports! Waterproof Headphones Sold Separately

The Waterproof iPod Shuffle is the most versatile Waterproof MP3 Player available. You can listen to your favorite songs in high fidelity underwater in the pool, ocean, gym, snow, rain, and use it as your everyday MP3 Player!

$179.95Details


About Face 3: The Essentials of Interaction Design

This completely updated volume presents the effective and practical tools you need to design great desktop applications, Web 2.0 sites, and mobile devices. This book will teach you the principles of good product behavior.

$45.00Details

A Very She & Him Christmas

She & Him have set out to create an intimate holiday recording of Christmas classics that helps bring new emotions out of old songs.

$9.99Details


Envirosax Rosa RO.P Shoulder Bag,Multi,One Size

Envirosax shopping bags carry a message of sustainable living to a world ready to embrace a brighter ecological future.

$38.50Details

Don't Make Me Think: A Common Sense Approach to Web Usability, 2nd Edition

100,000 copies sold. If you do anything web related, this book is a must read.

$40.00Details


Christmas In the Heart

2009 holiday release, the first Christmas album from the legendaryFolk/Rock singer/songwriter.

$10.99Details

Kate Spade iPhone 4 Tropical

This fun striped pattern is done in bold shades of lavender, yellow-gold,blue, fuschia, pink and lime.

$25.00Details


The Design of Everyday Things

Anyone who designs anything to be used by humans--from physical objects to computer programs to conceptual tools--must read this book, and it is an equally tremendous read for anyone who has to use anything created by another human.

$15.95Details

Lilly Pulitzer iPad & Netbook Sleeve - Nice To See You

Protect your iPad/NetBook in style.

$29.95Details


Pantone Universe Mug Violet 7672

The PANTONE UNIVERSE mugs by Whitbread Wilkinson are made with fine bone china.

$15.95Details

Back to Basics TEM500 Egg-and-Muffin 2-Slice Toaster and Egg Poacher

The Egg & Muffin Toaster brings innovation to the toaster category by combining the functions of a toaster and an egg poacher into one easy-to-use appliance.

$34.00Details



Anna Karenina

There is no doubt that Anna Karenina, generally considered Tolstoy's best book, is definitely one ripping great read.

$24.99Details

Hand Held Scalp Head Massager - Set of Three ( Colors May Vary )

It relieves tension as it softly massages acupressure points and stimulates sensitive nerves in your scalp.

$19.99Details


Bath Tissue Tyrant: Commode Dragon

Some dragons are helpful. Rest peacefully knowing this dragon is guarding the most important thing in the room.

$34.95Details

Mrs. Dalloway / A Room of One's Own

One of Virginia Woolf's greatest novels paired with an influential essay on the role of women in society.

$14.81Details


Orlando (Wordsworth Classics)

Virginia Woolf's Orlando 'The longest and most charming love letter in literature', playfully constructs the figure of Orlando as the fictional embodiment of Woolf's close friend and lover, Vita Sackville-West.

$4.99Details

TOTO Washlet - Temperature Controlled Toilet Seat

Cold Toilets are so yesterday.

$409.86Details


Magic Bullet MBR-1701 17-Piece Express Mixing Set

The magic bullet replaces a food processor, blender, and coffee grinder. Yet it occupies only the space of a coffee mug.

$38.49Details

Jedi Dressing Gowns - Star Wars Bath Robes

Those aren't the droids you're looking for.

$88.44Details


Just Kids

Just Kids begins as a love story and ends as an elegy. It serves as a salute to New York City during the late sixties and seventies and to its rich and poor, its hustlers and hellions. A true fable, it is a portrait of two young artists' ascent, a p

$10.88Details

I Am Trying to Break Your Heart - A Film About Wilco

This splendid documentary captures the band Wilco's struggles (both with their record company and within the band itself) while recording their album Yankee Hotel Foxtrot.

$24.49Details


Michael Kors Quartz, Mother of Pearl Dial with White Acrylic Link Band - Womens Watch MK5079

It has an eye-catching mother-of-pearl dial and bezel that are adorned with crystals that glisten like diamonds.

$140.63Details

Loudquietloud - A Film About the Pixies

The Pixies' 2004 reunion was the biggest thing that's happened in alternative rock since Nirvana, and filmmakers Steven Cantor and Matthew Galkin were there with their cameras, trailing the genre's progenitors across North America and Euro

$9.86Details


This is Spinal Tap (Special Edition)

You're about to get personal with one of music history's greatest and loudest heavy metal bands, Spinal Tap! Whether or not you're a die-hard fan of the group, you'll love this detailed "rockumentary" of Engand's legend

$7.49Details

Elephant Ring Holder - Silver

Store your rings on this adorable elephant's trunk.

$24.99Details


Shower Shock Caffeinated Soap

the original and world's first caffeinated soap from ThinkGeek. When you think about it, ShowerShock is the ultimate clean buzz ;)

$6.99Details

Michael Kors Perfume for Women 1 oz Eau De Parfum Spray

Creamy florals explode into exotic spices, tamed by Moroccan incense. A fragrant creation with a wealth of personality that will capture the heart of every woman.

$69.99Details


10 Sky Lanterns - White

Celebrate a special occasion with these amazing sky lanterns.

$28.99Details

Flowerbomb by Viktor & Rolf for Women - 3.4 Ounce EDP Spray

Launched by the design house of Viktor & Rolf.

$109.14Details


Trish Mcevoy No. 9 Blackberry & Vanilla Musk

TRISH MCEVOY NO. 9 BLACKBERRY & VANILLA MUSK by Trish McEvoy

$48.00Details

Kindle Fire, Full Color 7" Multi-touch Display, Wi-Fi

Kindle Fire isn't just for books anymore. Web, Apps, Video, Magazines, Music and More!

$199.00Details


Indian Healing Clay - 2 lbs - Clay

Aztec Secret Indian Healing Clay deep cleanses skin pores, removing dirt and impurities, lifting out poisons and toxins stored in the epidermis.

$7.52Details

Sweet Valley Confidential: Ten Years Later

Jessica and Elizabeth Wakefield are back and all grown up, dealing with the complicated adult world of love, careers, betrayal, and sisterhood.

$8.80Details


Helter Skelter Drinks Chiller

Warm drinks are so 20th century.

$33.18Details

Carhartt Women's Sandstone Sierra Jacket/Sherpa-Lined,Black,Medium

Our sandstone sierra jacket is sherpa-lined for added warmth. It's made of 12-ounce, 100% cotton sandstone duck and features princess back seams for a premium fit, built-in bi-swing for ease of movement, interior rib-knit storm cuffs, two inside poc

$89.68Details


Thera Cane Massager

Thera Cane self-massage device uniquely designed to apply pressure to sore muscles.

$29.95Details

True Fabrications Chain Bottle Rack

Use the magic chain to proudly show your wine anywhere. Simply put a bottle through the loop and let the chrome plated steel chain do the rest.

$24.95Details


Philips Hf3470/60 Wake-up Light, White

This alarm turns a light on slowly to help you wake up. Clinically proven to make waking up more pleasant.

$99.99Details

Better Sleep Pillow - A Multi Position Pillow for Side Sleepers, Stomach Slee...

Now you can enjoy the benefits of the most comfortable multi-functional doctor-approved pillow.

$99.99Details


Roulette Shot Glass Bar Drinking Game Set

The party starts when the ball stops rolling!

$29.99Details

Black Light Reactive Neon Makeup with Black Light Pendant (Yellow)

This awesome UV make up kit allows you to add neon flare to your boring every day make up.

$6.99Details


Smart Planet CDM-1 Corn Dog Maker

Make your very own corn dogs

$24.99Details

Cake Pop & Donut Hole Bakery

Make your own donut holes at home!

$24.99Details


Adjust-A-Cup 2-Cup Measuring Cup

Tired of having to deal with tons of different measurement cups and spoons? This elegant adjustable measuring cup solves everything.

$12.99Details

MollaSpace Cottage Incense Pot

A cement made cottage incense house. Watch the scented smoke coming out of the chimney and indulge yourself in the creativity.

$66.00Details


Think Geek Star Trek Enterprise Pizza Cutter

Boldly go where no pizza has gone before with Think Geek's Star Trek Pizza Cutter.

$24.99Details

Bed Fan

The Bed Fan delivers a cool breeze between the sheets--without AC costs, and without disturbing your partner.

$79.95Details


Swiss+Tech UKCSB-1 Utili-Key 6-in-1 KeyChain MultiTool

The lightest and most compact multi-use tool ever developed.

$7.50Details


Sterling Silver Peridot, Garnet, Amethyst, Blue Topaz and Citrine Individually Boxed Stud Earring Set

Add sparkle and variety to your wardrobe with this set of five individually boxed sterling silver stud earrings, showcasing five different colored gemstones.

$41.99Details

Pleo Dinosaur - A UGOBE Life Form

Pleo looks, moves, sounds and behaves like a living creature. Fully aware and cognitive, he explores his environment and interacts with people, accessories and other UGOBE dinosaurs.

$508.08Details


Chillow ® Comfort Device

The Chillow® is a noiseless, low-cost cooling alternative that is environmentally friendly

$23.95Details

6 Pool T-Shirt

Price in Euros

$15.00Details


Blendtec Total Blender Four Side, Black

It’s an all-in-one appliance that makes smoothies, fresh juice, ice cream, milkshakes, cappuccinos, margaritas, soups, sauces, breads, dressings, salsas, and more.

$399.99Details

Weber 386002 Q 100 Portable Propane Gas Grill

The grill ignites at the push of a button for reliable lighting, and an infinitely adjustable burner valve with a high-quality regulator makes it easy to control the heat.

$134.24Details


Sigma Beauty Flat Top Synthetic Kabuki - F80

This exclusive Flat Top Synthetic Kabuki was designed to deliver a flawless makeup application.

$23.38Details

Star Wars: The Complete Saga (Episodes I-VI) [Blu-ray]

The Ultimate Sci-Fi Series on Blu-Ray.

$86.99Details


Sci Fi Reference t-shirt

This is our remastered Sci-Fi movies reference t-shirt.

$19.95Details

LEGO Kids' 9002137 Star Wars Storm Trooper Mini-Figure Alarm Clock

A superb character mini figure style clock from the masters at Lego, featuring Alarm and a Snooze Button!

$23.99Details


Cards Against Humanity

Cards Against Humanity is a party game for horrible people. Unlike most of the party games you've played before, Cards Against Humanity is as despicable and awkward as you and your friends.

$25.00Details

Camelbak M.U.L.E. 100 oz Hydration Pack, Chili Pepper/Charcoal

The M.U.L.E. NV from Camelbak is a narrow-gauge pack for 3+ hours of all-terrain adventures in any weather.

$69.98Details


Flash Cooking System Sapphire Blue 000 by JETBOIL

Designed to capture and focus heat more efficiently than traditional cooking systems, the Flash brings two cups of water to a boil in only two minutes.

$80.71Details

Radica 20Q Artificial Intelligence Game - Colors may vary since the item may come in 3 different colors

I didn't believe it would work, but I tested the online version and it got 'Satellite' correct. Impressed.

$19.99Details


Fogless Shower Mirror with Squeegee by ToiletTree Products. Guaranteed Not to Fog, Designed Not to Fall.

Look your best by taking care of your face in your shower. This patent pending mirror is guaranteed not to fog in the shower.

$34.95Details


Marines T-Shirt

Marines Marines Marines

$17.00Details

Satechi CR -3600 car holder mount for iPhone 4S, 4, 3G & 3GS, BlackBerry Torch, HTC EVO, DROID, Samsung EPIC on Windshield and Dashboard

Using a smartphone as a GPS? Mount it in your car properly just like a traditional GPS.

$29.99Details


e-Sports Shirt

E-Sports

$17.00Details

4 Gate Shirt

Price in Euros

$15.00Details


3 Rax Shirt

Price in Euros

$15.00Details


Sub Zero Macbook Decal Mac Apple skin sticker

Make your Mac Book go Sub-Zero in coolness.

$15.99Details

Stryker the Smoking Dragon Sculptural Incense Box

A peaceful house starts with dragons and incense.

$24.95Details


Wii Classic Controller Pro - Black

Created for accessibility and comfort, the Classic Controller Pro blends design elements from game systems such as the NES, Super NES, and Nintendo 64 providing seamless play control for a wide range of games.

$19.99Details

Men's Tetris Tie by Game Tie in Black

The classics of menswear and video games have finally come together to bring you this remarkable men's Tetris necktie.

$35.00Details


Cute Fire Extinguisher Lighter With LED Light

Irony is always in style, right? Light up with this extinguisher.

$9.00Details

All My Friends Are Dead

All My Friends Are Dead presents a delightful primer for laughing at the inevitable.

$9.95Details


Henry Darger

This large-format, lavishly illustrated volume presents the iconic American outsider artist in a new critical light, locating him for the first time as a major figure in the history of contemporary art.

$53.55Details


Star Wars Interactive R2D2

Dancing to Cantina Music, bringing you drinks and guarding your precious stuff. What more could you ask for from the most faithful robot in the galaxy?

$199.99Details

Air Swimmer Remote Control Inflatable Flying Shark

Flying Sharks. Who wouldn't want one?

$39.99Details


Sense and Sensibility

Jane Austen's most famous novel. It's about the necessity of finding a workable middle ground between passion and reason.

$9.99Details

Umbra FishHotel Aquarium

Is your fish getting to old to live at home? This condo is the perfect balance of freedom and comfort for your beloved fish.

$38.50Details


Life

With The Rolling Stones, Keith Richards created the songs that roused the world, and he lived the original rock and roll life. Now, at last, the man himself tells his story of life in the crossfire hurricane.

$11.55Details

THE EX Kitchen Knife Set by Raffaele Iannello, Black

Not only functional, but also therapeutic, this five-piece knife set plus holder makes for the perfect gift and a guaranteed conversation piece.

$169.99Details


Bamboo Wirelesskeyboard & Mouse

Environmentally friendly keyboard and mouse combo

$142.09Details

Doctor Who 11 Doctors 5" Action Figure Collector Set

This boxed set features 5 inch figures of the eleven men to portray the Doctor in the BBC series, with new costumes and new sculpts.

$99.99Details


Madame Bovary

A story of a woman trapped in a loveless marriage in 19th century France.

$18.49Details

Swinging Sticks Kinetic Energy Sculpture

The Swinging Sticks Kinetic Energy Sculpture is a high end, museum quality moving display that is ideal for offices, lobbies, waiting rooms, and conference rooms.

$229.99Details


Big Mouth Toys Toilet Mug

A toilet bowl full of brown liquid, that's just tasteless. Or funny.

$10.97Details

The Portrait of a Lady (Penguin Classics)

A story of intense poignancy, Isabel's tale of love and betrayal still resonates with modern audiences.

$12.00Details


USBCELL AA Rechargable Battery

Can't find your charger? USBCELL AA Rechargeable Batteries work just like normal rechargeable batteries--but simply pop off the lid to recharge by any powered USB Port.

$19.95Details

Transformer USB Flash Memory Drive 4GB

This USB drive transforms from Leopard to USB stick in seconds.

$9.80Details


World Of Warcraft Deluxe Latex Mask, Troll, Green, One Size

Sometimes I wish I could roam around the mall like it were Azeroth. Now I can with my World of Warcraft Troll Mask!

$36.99Details

iMPROV Electronics 8.5" Boogie Board Tablet

You can utilize this writing tablet for home, office or school activity and you will never need a paper or pencil again.

$34.95Details


Nintendo Wall Graphics - Super Mario Bros

Level up your room with this Mario Themed wall graphics.

$74.95Details


Extremely Loud and Incredibly Close MTI: A Novel

Nine-year-old Oskar Schell has embarked on an urgent, secret mission that will take him through the five boroughs of New York.

$9.96Details

Zen Magnets - Gift and Retail Packed Zen Set

Zen Magnets. These super powerful and tiny magnets are a lot of fun for kids and adults.

$59.95Details


Super Mario Time to Team Up 50-by-60-Inch Microraschel Throw Blanket

Mario and Luigi race to save the game surrounded by icons and characters from your favorite video game. Cuddle up in this warm throw for a long day of video game fun.

$29.99Details

Ten One Design Fling Game Controller - Ninja

Fling is a tactile game controller for iPad.

$9.50Details


Drinkwell Platinum Pet Fountain

Pet water fountain.

$44.06Details

Handcrafted Figured Mahogany Case for iPhone 4/4S

Protect your phone with classic style.

$69.95Details


Fred and Friends PIBOSS Pizza Boss Pizza Wheel

Sick of cutting pizza with a knife? Tired of cutting yourself with a pizza cutter?

$15.00Details

Modern Single Handle Waterfall Bathroom Vanity Vessel Sink LED Faucet, Chrome

This amazing LED faucet changes color with the temperature of the water.

$59.99Details


Mindflex Duel Game

Mindflex Duel is the ultimate head-to-head brain game challenge

$74.99Details

The Picture of Dorian Gray

Dorian Gray, a handsome young man, receives a beautiful painting of himself from his good friend Basil Hallward. In the same moment, a new acquaintance, Lord Henry, introduces Dorian to the ideals of youthfulness and hedonism, of which Gray becomes immed

$6.95Details


Letters to a Young Poet

Those looking for an alluring image of the solitary artist--and for an astonishing quotient of wisdom--will find both in Letters to a Young Poet.

$4.99Details

Desktop Warfare Kits (Catapult)

Your own personal catapult.

$25.99Details


Wookiee Cookies: A Star Wars Cookbook

Tusken Raider Taters, Yoda Soda, C-3PO Pancakes... mmmm sounds delicious!

$18.99Details

Norpro Nonstick Cake-Sicle Pan with 24 Sticks

I wish I had thought of this. Cakesicles. mmmm.... delicious

$19.99Details


Vera Bradley Convertible Kisslock in Lemon Parfait

A wallet by day and a purse by night, this convertible accessory is fun, flirty and large enough to hold a Smartphone.

$27.95Details

Peekaru Original Fleece Baby Carrier Cover Medium - Black

Share the warmth with your baby or toddler. The Peekaru Original is an environmentally friendly fleece vest that fits over you and your baby, keeping you both warm without giving up the comfort of your favorite baby carrier.

$79.95Details


Kymera Magic Wand Remote Control

Imagine walking into the room with your children and their Muggle friends watching TV, whipping out a magic wand from under your jacket and changing the channel in a flash.

$89.99Details

Clear Blue Hawaii Molokini 2 - Person Kayak

Transparent Molokini Kayak. Discover. Explore. See. Witness fascinating lake or sea life through the sleek transparent hull. This is a great investment whether your goal is serious research or a child's voyage of discovery.

$2,243.17Details


OPI Nail Polish You Don't Know Jacques! 0.5 oz.

Beautiful nails are always in style.

$8.09Details

OPI NAIL POLISH - MRS O'LEARY'S BBQ #W44

Beautiful nails are always in style.

$2.75Details


OPI Teenage Dream-Katy Perry Polish

Beautiful nails are always in style.

$8.99Details

LEGO Star Wars Ultimate Collector's Millennium Falcon

Han Solo's famous starship is crafted from over 5,000 Lego pieces.

$499.99Details


OPI Silver Shatter Nail Polish NL E62

Beautiful nails are always in style.

$6.49Details

Iron Man 2 Macbook Decal Mac Apple skin sticker

A wise man once asked, Is it better to be feared or respected? I say, is it too much to ask for both?

$15.99Details


Kurt S. Adler 10-Light Star Wars R2D2 Light Set

This novelty light set features 10 R2D2 lights with 30-inch lead wire and 12-inch spacing.

$30.00Details

Flawless Sterling Silver Floating Heart, 13/16" X 13/16"

Beautiful Floating heart. Solid Sterling Silver, Excellent mirror like finish.

$79.95Details


Glow in the Dark Toilet Roll

Don't like turning the light on when you need an impromptu midnight wee? Your aim may be rubbish, but at least you can find the toilet paper thanks to our Glow in the Dark Toilet Roll!

$7.60Details

Satya Jewelry Silver Turquoise, Hamsa, Lotus Charm Necklace

Turquoise, the stone of healing, and the Hamsa which protects against negative energies, meet the lotus as a symbol of renewal and transformation.

$98.00Details


Fred & Friends Beat It Chopsticks Set

One end of each chopstick is a regualr chopstick shape while the other end of of the chopstick is in the shape of a drumstick.

$14.99Details

Bling Jewelry Sterling Silver Turquoise Five-strand Bracelet [Jewelry]

Five strands of hand-strung turquoise nuggets are attached to a .925 sterling silver bar clasp.

$39.99Details


Bling Jewelry Sterling Silver Elongated Teardrop Bangle Bracelet

This bracelet is great for every day wear and elegant for dressy affairs.

$49.99Details

Dynaflex Iron Power Force 1 - Silver, Metal Powerball

The Iron Power Force One Gyro creates up to 16,000 rpm and 50 pounds of silky-smooth dynamic resistance in the palm of your hand.

$99.89Details


Stainless Steel Aqua Resin Dome Ring

Beautiful Stainless Steel Aqua Resin Dome Ring

$31.99Details


Reamde: A Novel

Reamde is a swift-paced thriller that traverses worlds virtual and real. Filled with unexpected twists and turns in which unforgettable villains and unlikely heroes.

$18.99Details

Levitron AG Anti-Gravity Globe

Observe Earth levitate in space - only touching air!

$79.99Details


Steve Jobs

Autobiography of Steve Jobs

$17.87Details

(4gb MicroSD Bundle) US Mint 1/2 Dollar - Micro SD Card Covert Coin - Secret Compartment

Spy coin helps you turn every day objects into a secret compartment.

$34.99Details


Looxcie Wearable Bluetooth Camcorder System, Android Compatible (Black)

Record what you're seeing directly to your phone.

$199.00Details

Halo 3, Master Chief Costume, Adult Standard

Quilted jumpsuit with EVA armor, two-piece deluxe helmet, gauntlets and boot tops.

$580.46Details


Aperture Science Mug

Welcome to Aperture Laboratories, A Trusted Friend in Science!

$12.99Details


Chessex Dice: Pound of Dice (Pound-O-Dice) Approximately 100 Die

For only the most extreme board game player or gambler.

$18.85Details

Sphere Pen Camera - Hidden Video Spy Pen

1.5 hours of high quality video stored on 4GB memory card.

$99.99Details


3M Self Adhesive Dry Erase Material. 24"" x 10-Feet Long.

Turn any wall into a dry erase board.

$12.50Details

Hydrofarm HGTL Thirsty Light Original Digital Indoor Plant Moisture Sensor

When a plant's soil becomes dry, the LED on the Thirsty Light blinks to let you know.

$9.15Details


Can You Imagine 2320 Melting Clock

A Dali-eque functioning clock.

$14.99Details

Starcraft II 2 Collectors Edition Art book

Starcraft 2 limited edition Art book! This was only available in the SOLD out Collectors Edition! This is for the Limited Edition Art book only!

$50.87Details


men's zergling tshirt

lings like music too

$20.00Details

StarCraft Widescreen DVD Movie Special Limited Edition

All the Cut-Scenes from the game on DVD

$22.97Details


Team Dignitas Hoodie

Team Dignitas 2011 Hoodie's. (Price in Euros)

$48.95Details

Tastosis T-Shirt

The Casting Archon

$25.00Details


The StarCraft Bible 2nd Edition: Who knew that explosions of pixels could inspire?

This is the history of StarCraft. This is the love of e-sports. This is the Bible of StarCraft.

$16.99Details

Priceless MLG

For the things money can't buy.

$25.00Details


Starcraft II: Wings of Liberty

Starcraft 2: Wings of Liberty (Game)

$49.99Details

Gosu T-Shirt

Remind everyone.

$22.50Details


Terran Dog Tag

Lovely Starcraft II Terran Dog Tag Necklace

$55.00Details

Gimme Your Ladder Points T-Shirt

Beating Up Nerds Since Beta

$21.50Details


Zerg Dog Tag

StarCraft 2 ZERG Dog Tag Necklace

$55.00Details

More GG, More Skill T-Shirt

White-Ra's Mantra

$22.50Details


Protoss Dog Tag

StarCraft 2 Protoss Dog Tag Necklace

$55.00Details

Top 3 Control T-Shirt

Huk, ?, and You!

$22.50Details


Revolution Overdrive: Songs of Liberty Vinyl

This StarCraft II Collectors Vinyl features never before released music from Joeyray's Bar. Printed on a dual sided picture disk, this high quality collector's item is ready for framing or playing on that old record player.

$25.00Details

Release The Gracken T-Shirt

If you can't beat'em, you might as well buy the t-shirt. Featuring IdrA.

$24.95Details


Echoes of War

Simply put, Echoes of War could be summed up as an album of orchestrated music from the games of Blizzard Entertainment StarCraft, Warcraft, Diablo and World of Warcraft.

$49.95Details

Evil Geniuses Team Jersey

Official EG Team Jersey

$24.95Details


Pwned Mug

PWNED.

$9.99Details

Larva Inject T-Shirt

In order to protect your children from extremely deadly and contagious 2 barracks rushes, make sure they're up to date with their larva injects.

$19.99Details


e-Sports Shirt

Sure I can't beat you in one-on-one basketball, but how's your macro?

$19.99Details


All American 921 21-1/2-Quart Pressure Cooker/Canner

This heavy-duty pressure cooker's large capacity is probably best utilized for canning (though it would also be great for a number of cooking tasks).

$199.99Details

NaNiWa T-Shirt

It is simple.

$24.95Details


Thermos Stainless King SK1005MB4 16-Ounce Leak-Proof Travel Mug, Midnight Blue

The ultra-durable, leak-proof Thermos Stainless King travel mug features an unbreakable stainless steel interior and exterior, making it a great companion for use in rough-and-tumble situations such as construction sites, delivery work, and more.

$19.43Details

Prime Winter Uniform

Dress like Marine King.

$80.00Details


Prime Padded Jacket Uniform

Stylish winter uniform from Prime team.

$200.00Details

I Heart eSports Sticker Bundle

Collection of 4 High-quality vinyl stickers

$7.70Details



Team Liquid poster

TL Triple Horse Poster

$12.95Details

Audio-Technica ATH-M50 Professional Studio Monitor Headphones

One of the most popular headphone sets in existence. Designed for DJs/Producers, they are fantastic for anyone.

$159.00Details


StarCraft II Random Race T-Shirt XL

Random Starcraft Shirt

$19.99Details

Fasta Pasta The Microwave Cooker

No waiting for a big pot of water to boil. Cook pasta to al dente perfection in the microwave! Saves time, energy and water.

$8.99Details


StarCraft Protoss Ready to Serve T-Shirt

Zealot is Ready to Serve

$19.99Details

DAY[9] Grunge Premium Tee

Day 9 Wears It, So Should You!

$19.99Details



Sea to Summit Pocket Shower

Bring an 8 minute shower anywhere you go. Also works as a regular dry sack.

$24.21Details

Zippered Earphones

No more tangled earphone mess.

$39.99Details


Sport-Brella Umbrella Chair, Blue

Tired of all the shady spots being taken? Bring your own chair and shade together!

$39.99Details

Multi Green Laser 5mw

As seen on ghost hunters. You know it is legit now!

$11.75Details


Glow Graffiti Toolset - Paint with Light

It's the dead of night; everyone is tucked up in bed and the owls are-a-hooting. So it's time to break out the Glow Graffiti!

$34.99Details

Infrared Mini Radio Controlled Marine Cobra Helicopter Gyro

Mini remote control helicopter. USB charger.

$24.94Details


Fred and Friends OCD Cutting Board

Cut everything to perfection.

$25.00Details


Emile Henry Flame Top Pizza Stone, Black

Create marvelous pizzas at home.

$50.00Details

Pet Umbrella (Dog Umbrella) Keeps your Pet Dry and Comfotable in Rain

Keep your pet happy and dry in rain, sleet or snow!

$14.95Details


Star Wars Storm Trooper USB Drive 4GB

Storm Trooper USB stick.

$34.99Details

Garden Zombie

There's A Zombie On Your Lawn! Nobody was quite sure what caused it. An alien pathogen riding the tail of Halley's Comet? Some government "rage" virus? Radiation from a downed satellite?

$89.99Details


Lumisource NESSIE Table Desk Lamp

Inspired by Nessie the Lochness Monster, this light keeps your kids company and is fun to play with.

$45.00Details

Men's Play Money Tie by Fun Ties in Black

This unique novelty tie features colorful play money on a durable black polyester fabric. This necktie is worth a million dollars, well a million dollars in play money.

$25.00Details


Suck UK Skate Mirror

The Skate Mirror is made from stainless steel and mirrored glass, as well as genuine skate trucks.

$200.00Details

Ergo Lounger RS Therapeutic Face Down Lounger, Aluminum

Ergonomically designed aluminum chaise lounger with a face hole designed to relieve disk and nerve pain.

$149.00Details


Silver Robot 8GB Flash Drive

When it comes to file storage, you want something as reliable as your favorite lovable robot.

$44.99Details

Bladefish 5000 Powerfull Underwater Scooter

The BladeFish can get up to 3.75 mph and has a run time up to 2 hours.

$820.00Details


MATH CLASS Wall Clock mathematics teacher classroom gift

I probably will never know what time it is again.

$22.99Details

The Slanket Blanket-Moss Green

A blanket that doesn't make you feel trapped.

$49.95Details


Iron Man Mark II 12 Inch Deluxe Figure

This is a must for any collector Iron Man in this full body titanium color suit just like thr prototype in the movie.

$999.99Details

MANGROOMER Do-It-Yourself Electric Back Hair Shaver

The Mangroomer Do-It-Yourself Electric Back Shaver is absolutely the best way to get rid of unwanted back hair.

$39.99Details


Obol, the Never-Soggy Cereal Bowl

Soggy cereal is a problem of the past.

$19.99Details

Swimline Kickback Adjustable Lounger, Double

The Swimline KickBack Double Adjustable Lounger features infinite adjustability and ultimate comfort for two.

$79.99Details


Boon Glo Nightlight with Portable Balls, White

Boon Glo nightlight. Portable, don't heat up, turn off after 30 minutes and 95% effective at keeping monsters away all night long.

$84.99Details

Munchkin Mozart Magic Cube

A true breakthrough in music education, the Munchkin Mozart Magic Cube will be music to your baby's ears.

$15.00Details


Razer Banshee StarCraft II Gaming Headset

With its circumaural design the Razer Banshee is designed for optimal sound isolation to allow you to focus completely on your game.

$100.23Details

Razer Spectre StarCraft II Gaming Mouse

Razer Spectre StarCraft II gaming mouse is a lightweight, five button mouse that is ideal for gamers that prefer precision and control for an RTS.

$63.11Details


Razer StarCraft II Zerg Edition Messenger Bag

The Starcraft II Zerg Edition Messenger Bag is designed for gamers who want to keep their gear protected, stay comfortable, and look good doing it.

$59.77Details

Presto 03430 Pizzazz Pizza Oven

The fast and easy way to bake fresh or frozen pizza. Great for frozen, homemade, take-and-bake, or deli pizza. The easy way to prepare chicken nuggets, quesadillas, fish fillets, even grilled sandwiches.

$39.96Details


SteelSeries QcK Starcraft II Gaming Mouse Pad-Kerrigan Vs. Zeratul Edition

The SteelSeries QcK Kerrigan vs. Zeratul Edition mousepad is made of a high quality cloth material, providing a precise and consistent glide.

$14.12Details

iRobot 530 Roomba Vacuuming Robot, White

This specific Roomba model systematically cleans up to three* rooms on a single charge and gets into hard-to-reach wall edges and beneath furniture, while avoiding stairs and other drop-offs.

$249.99Details


StarCraft II 2012 Wall Calendar

Players will love this exciting calendar with its vivid images of their favorite heroes as they struggle for survival on the edge of the galaxy. Includes removable stickers to mark your keyboard with memorable plays!

$10.19Details

Starcraft II: Heaven's Devils

For the first time ever, StarCraft enthusiasts will learn the origins of the enduring friendship between the young upstart Jim Raynor and the streetwise soldier Tychus Findlay.

$10.00Details


Starcraft II: Devils' Due

Devils' Due recounts an unforgettable period of Jim Raynor's life as he descends into the Koprulu sector's criminal underworld alongside the street-savvy Findlay.

$17.16Details

Joby GP1-E1EN Gorillapod Flexible Tripod (Grey)

Gorillapod lets you mount your camera just about anywhere you want so that you can include everyone in your automatic shots.

$14.26Details


Starcraft 2 Logo T-Shirt

Starcraft 2 Logo T-Shirt

$19.99Details

Starcraft Zerg Logo T-Shirt

Represent the Swarm

$19.99Details


Nikon D5000 12.3 MP DX Digital SLR Camera with 18-55mm f/3.5-5.6G VR Lens and 2.7-inch Vari-angle LCD

A remarkable blend of simplicity and highly-advanced DSLR capabilities, the compact and powerful D5000 offers breathtaking 12.3-megapixel image quality, along with a flexible, Vari-angle, Live View monitor for fresh picture-taking perspectives.

$769.95Details

StarCraft II Protoss Vintage Logo T-Shirt

Show off Your 4 Gate Pride.

$19.99Details


StarCraft II Terran Vintage Logo T-Shirt

You're Terran Up My Heart

$19.99Details

StarCraft II Diamond League T-Shirt

Almost masters, I swear!

$19.99Details


StarCraft II Logo Keychain

Improve your Key APM

$7.99Details

Cuisinart GR-4N 5-in-1 Griddler

Compact in size but big in features, Cuisinart's countertop Griddler offers five-in-one functionality as a contact grill, panini press, full grill, full griddle, and half grill/half griddle.

$80.25Details


SteelSeries QcK Starcraft II Gaming Mouse Pad-Tychus Findlay Edition

Made of a high-quality cloth material with an optimized textured surface, the SteelSeries QcK Limited Edition (StarCraft II Tychus Findlay), provides players with both a smooth and consistent gliding surface.

$14.99Details

Starcraft II 2 Dog Tag USB 2gb drive James Jim Raynor

Starcraft 2 Dogtag USB Stick ensures you're the coolest kid at the lan party.

$90.00Details


Presto Pro EverSharp Electric Knife Sharpener

Razor sharp knives whenever you want - easy, automatic. Professional two-stage system sharpens in seconds. Blade guides automatically hold knife at ideal sharpening angle.

$27.00Details

Starcraft II Wings of Liberty Button Badge 4-Pack

Starcraft II Wings of Liberty fans will love this set featuring logos from Zerg, Protoss, Terran, and Starcraft II.

$7.99Details


AeroGarden 2101-00B Classic Garden 7-Pod With Gourmet Herb Seed Kit - Black

Enjoy the taste and fragrance of fresh herbs, vegetables and salad greens grown right in your kitchen. The AeroGarden grows them all with no dirt, mess or pesticides.

$149.95Details


StarCraft II: Heart of the Swarm (Pre-Order)

Heart of the Swarm expansion for Starcraft 2

$59.99Details

Starcraft II Mega Bloks BlizzCon 2011 Exclusive Limited Edition Set Battlecruiser

Blizzcon exclusive 1,736 piece Battlecruiser preview set limited edition of 3,000 worldwide.

$299.99Details


Team Liquid T-shirt

TL Horse Logo Shirt - Steel

$21.95Details

I Love Starcraft T-Shirt

I Love Starcraft from Blizzard

$22.00Details


Learning Resources Zoomy Handheld Digital Microscope

Amazing all-in-one digital microscope takes scientific inquiry to a new level - yet is easy for even a young child to use.

$59.95Details

SC 2 Gaming Gloves

Warm hands means higher APMs

$17.00Details


Razer Marauder StarCraft II Gaming Keyboard

The Razer Marauder StarCraft II gaming keyboard is a full featured, tournament ready keyboard with an extremely compact design.

$98.35Details

© Gift Lizard 2011