×

Find gifts by describing the person you are trying to buy for. Use things like who they are (dad), their hobbies (star wars), their personality (geek, gamer).

You searched for: dadgeekgamerstar warsminecrafttravelkidsdrinkinggamesgame of throneslight

Reset Tags. (Click a tag to remove it. Add tags on the left side.)

Kurt S. Adler 10-Light Star Wars R2D2 Light Set

This novelty light set features 10 R2D2 lights with 30-inch lead wire and 12-inch spacing.

$30.00Details

LEGO Star Wars Ultimate Collector's Millennium Falcon

Han Solo's famous starship is crafted from over 5,000 Lego pieces.

$499.99Details


Swiss+Tech UKCSB-1 Utili-Key 6-in-1 KeyChain MultiTool

The lightest and most compact multi-use tool ever developed.

$7.50Details

Bananagrams

The Anagram game that will drive you bananas. The award-winning word game that needs no pencil, paper, or board. Fast and fun.

$14.95Details


Sea To Summit Ultra-Sil Daypack

Backpack that fits on a keychain.

$26.96Details


Men's Tetris Tie by Game Tie in Black

The classics of menswear and video games have finally come together to bring you this remarkable men's Tetris necktie.

$35.00Details

Star Wars Interactive R2D2

Dancing to Cantina Music, bringing you drinks and guarding your precious stuff. What more could you ask for from the most faithful robot in the galaxy?

$199.99Details


Nintendo Wall Graphics - Super Mario Bros

Level up your room with this Mario Themed wall graphics.

$74.95Details

Super Mario Time to Team Up 50-by-60-Inch Microraschel Throw Blanket

Mario and Luigi race to save the game surrounded by icons and characters from your favorite video game. Cuddle up in this warm throw for a long day of video game fun.

$29.99Details


Jedi Dressing Gowns - Star Wars Bath Robes

Those aren't the droids you're looking for.

$88.44Details

Radica 20Q Artificial Intelligence Game - Colors may vary since the item may come in 3 different colors

I didn't believe it would work, but I tested the online version and it got 'Satellite' correct. Impressed.

$19.99Details


Wii Classic Controller Pro - Black

Created for accessibility and comfort, the Classic Controller Pro blends design elements from game systems such as the NES, Super NES, and Nintendo 64 providing seamless play control for a wide range of games.

$19.99Details

Pleo Dinosaur - A UGOBE Life Form

Pleo looks, moves, sounds and behaves like a living creature. Fully aware and cognitive, he explores his environment and interacts with people, accessories and other UGOBE dinosaurs.

$508.08Details


Mindflex Duel Game

Mindflex Duel is the ultimate head-to-head brain game challenge

$74.99Details

Operation Star Wars Edition

R2D is on the blink and looking for a steady hand to help. Can you repair a cranky crankshaft or a hiccupping hologram?

$26.93Details


LEGO Kids' 9002137 Star Wars Storm Trooper Mini-Figure Alarm Clock

A superb character mini figure style clock from the masters at Lego, featuring Alarm and a Snooze Button!

$23.99Details

Sci Fi Reference t-shirt

This is our remastered Sci-Fi movies reference t-shirt.

$19.95Details



Weber 386002 Q 100 Portable Propane Gas Grill

The grill ignites at the push of a button for reliable lighting, and an infinitely adjustable burner valve with a high-quality regulator makes it easy to control the heat.

$134.24Details

Star Wars: The Complete Saga (Episodes I-VI) [Blu-ray]

The Ultimate Sci-Fi Series on Blu-Ray.

$86.99Details


Fred Cool Jazz Ice Cube Tray

It is time to kick back and chill and here is a cool way to do it! Drop one of these groovy guitars into your drink, and give it a stir. Just the thing for jazzing up your favorite beverage.

$7.99Details

True Fabrications Chain Bottle Rack

Use the magic chain to proudly show your wine anywhere. Simply put a bottle through the loop and let the chrome plated steel chain do the rest.

$24.95Details


Multi Green Laser 5mw

As seen on ghost hunters. You know it is legit now!

$11.75Details

Boon Glo Nightlight with Portable Balls, White

Boon Glo nightlight. Portable, don't heat up, turn off after 30 minutes and 95% effective at keeping monsters away all night long.

$84.99Details


Zen Magnets - Gift and Retail Packed Zen Set

Zen Magnets. These super powerful and tiny magnets are a lot of fun for kids and adults.

$59.95Details

Sport-Brella Umbrella Chair, Blue

Tired of all the shady spots being taken? Bring your own chair and shade together!

$39.99Details


Philips Hf3470/60 Wake-up Light, White

This alarm turns a light on slowly to help you wake up. Clinically proven to make waking up more pleasant.

$99.99Details

SHOT GLASS ICE MOLD (13PC. SET)

Take the chill off your next soiree when you serve guests a shot in an edible frozen glass.

$14.99Details


Star Wars Storm Trooper USB Drive 4GB

Storm Trooper USB stick.

$34.99Details


The Hungover Cookbook

Learn to cure your hangover with these delicious recipes!

$10.00Details

Lumisource NESSIE Table Desk Lamp

Inspired by Nessie the Lochness Monster, this light keeps your kids company and is fun to play with.

$45.00Details


Das Boot

Das Boot.

$34.99Details

Mr. Beer Premium Gold Edition Home Brew Kit

A great starting point for a beginning and intermediate brewers, it includes two of Mr. Beer's most popular beer mixes as well as everything needed to both brew and bottle your first 2 batches of top-quality beer.

$59.99Details


Pool Table, Tabletop

Mini pool table.

$39.95Details

Exhaust Powered Car Jack

Jack your car up with the exhaust it's generating, simple and elegant car repair.

$224.98Details



Hops Holster 12 Can Ammo Pack

When you're ready to wage war on thirst (and possibly sobriety) the Hops Holster 12 Can Ammo Pack is the only beer holder gear you need.

$39.95Details

Desktop Warfare Kits (Catapult)

Your own personal catapult.

$25.99Details


IMCG Fridge Monkey - Charcoal

Bottles, Cans and drinks in general shouldn't fall out of the fridge ever again.

$7.99Details

Cuponk Boomshakalaka

Sink your ball into the cup and light it up. Get it in and you'll hear the sweet sounds of victory.

$19.77Details


Levitron AG Anti-Gravity Globe

Observe Earth levitate in space - only touching air!

$79.99Details

Infrared Mini Radio Controlled Marine Cobra Helicopter Gyro

Mini remote control helicopter. USB charger.

$24.94Details


Halo 3, Master Chief Costume, Adult Standard

Quilted jumpsuit with EVA armor, two-piece deluxe helmet, gauntlets and boot tops.

$580.46Details

Roulette Shot Glass Bar Drinking Game Set

The party starts when the ball stops rolling!

$29.99Details


Aperture Science Mug

Welcome to Aperture Laboratories, A Trusted Friend in Science!

$12.99Details

Men's Play Money Tie by Fun Ties in Black

This unique novelty tie features colorful play money on a durable black polyester fabric. This necktie is worth a million dollars, well a million dollars in play money.

$25.00Details


10 Sky Lanterns - White

Celebrate a special occasion with these amazing sky lanterns.

$28.99Details

Kindle Fire, Full Color 7" Multi-touch Display, Wi-Fi

Kindle Fire isn't just for books anymore. Web, Apps, Video, Magazines, Music and More!

$199.00Details


Tasting Beer: An Insider's Guide to the World's Greatest Drink

Everything you ever wanted to know about beer!

$16.95Details

Kymera Magic Wand Remote Control

Imagine walking into the room with your children and their Muggle friends watching TV, whipping out a magic wand from under your jacket and changing the channel in a flash.

$89.99Details


Kotobukiya Samurai Sword Chopsticks Set: Date Masamune

The way of the warrior starts at the dinner table! Based off of real samurai warriors! Meals with honor!

$11.99Details

Stryker the Smoking Dragon Sculptural Incense Box

A peaceful house starts with dragons and incense.

$24.95Details


Air Swimmer Remote Control Inflatable Flying Shark

Flying Sharks. Who wouldn't want one?

$39.99Details

Credit Card Lightbulb

Never be afraid of the dark again. This mini light bulb is credit card size and can go with you anywhere.

$2.00Details


World Of Warcraft Deluxe Latex Mask, Troll, Green, One Size

Sometimes I wish I could roam around the mall like it were Azeroth. Now I can with my World of Warcraft Troll Mask!

$36.99Details

Fred and Friends Hopside Down Glass

Hopside Down, is that pun not enough of a description?

$20.00Details


Harvil Tabletop Air Hockey Table

The Harvil Tabletop Air Hockey Table is a lightweight and affordable way to introduce the fun of air hockey to children.

$149.44Details

Wookiee Cookies: A Star Wars Cookbook

Tusken Raider Taters, Yoda Soda, C-3PO Pancakes... mmmm sounds delicious!

$18.99Details


Star Wars Science - Force Trainer

May the Force be with you! The Force Trainer by Uncle Milton actually allows you to control a Jedi Training Remote with your mind, by tapping into cutting-edge brainwave technology.

$35.95Details

Thermos Stainless King SK1005MB4 16-Ounce Leak-Proof Travel Mug, Midnight Blue

The ultra-durable, leak-proof Thermos Stainless King travel mug features an unbreakable stainless steel interior and exterior, making it a great companion for use in rough-and-tumble situations such as construction sites, delivery work, and more.

$19.43Details


PUR 18 Cup Dispenser with One Pitcher Filter DS-1800Z

Keep your water clear of chemicals and odors with this dispenser from PUR. Its advanced filtration system reduces more contaminants (lead, copper, zinc, etc.) than any other pour-through filter.

$27.81Details

Lightphoria 10,000 lux SAD Light Therapy Pad (Seasonal Affective Disorder) Sunlight Simulator. 2011 model (v2.1)

Bright light has been used for over a decade to alleviate symptoms associated with Seasonal Affective Disorder (SAD), jetlag, shift work fatigue, insomnia, seasonal change and more.

$99.99Details



Learning Resources Zoomy Handheld Digital Microscope

Amazing all-in-one digital microscope takes scientific inquiry to a new level - yet is easy for even a young child to use.

$59.95Details

Uncle Milton Lightsaber Room Light

Construct your own Jedi lightsaber and mount your creation as a room light on the wall. Eight color effects let kids personalize their lightsaber, and a wireless remote control turns the light on and off.

$24.99Details


Uncle Milton Star Wars Science Death Star Planetarium

This table top Death Star opens up into a planetary projector to display the cosmos on your bedroom ceiling.

$19.88Details

Star Wars Bath Playset

Includes R2D2, C3PO, Yoda, Darth Vader, Boba Fett, Stormtrooper, and Chewbacca

$35.99Details


Star Wars: The Old Republic

Star Wars: The Old Republic is a Massively Multiplayer Online Role-playing Game

$59.95Details

Kinect Star Wars

Feel the Force as you transform yourself into a Jedi. Fully harnesses the power of the Kinect platform to deliver a natural and intuitive Star Wars experience.

$49.96Details


LEGO Kids' 9002113 Star Wars Darth Vader Mini-Figure Alarm Clock

This LEGO Darth Vader clock is a must-have addition to the night table, dorm room or executive desk of any Star Wars fan.

$29.99Details

Steampunk Ring Aria Lilac - Eye of the Dragon - Game of Thrones

Vintage, Recycled, and Unique Handmade and Handcrafted, Gemstone, Crystal and Pearl Jewelry

$45.00Details


King Robert's Warhammer

Rhaegar fought valiantly, Rhaegar fought nobly, Rhaegar fought honorably. And Rhaegar died.

$270.00Details

Ice, Sword of Eddard Stark, Damascus Edition

If you would take a man's life, you owe it to him to look into his eyes and hear his final words. And if you can not do that, then perhaps the man does not deserve to die.

$700.00Details


Game of thrones Dark T-Shirt by CafePress

Winter is Coming. Maybe it's already here. Get a T-Shirt!

$27.00Details

Young Robert Baratheon

This would be from around the time of the Battle of the Ruby Ford.

$9.99Details


Game of Thrones Tyrion Lannister Men's T-Shirt, Medium

Tyrion Lannister T-Shirt. Surely this won't increase your debt much.

$17.99Details


Audio-Technica ATH-M50 Professional Studio Monitor Headphones

One of the most popular headphone sets in existence. Designed for DJs/Producers, they are fantastic for anyone.

$159.00Details


Fasta Pasta The Microwave Cooker

No waiting for a big pot of water to boil. Cook pasta to al dente perfection in the microwave! Saves time, energy and water.

$8.99Details

Longclaw, Sword of Jon Snow. Licensed from George R.R. Martin's "A Game of Thrones"

For five centuries the Valyrian steel sword Longclaw was carried by the Lords of Bear Island in the service of the Starks of Winterfell.

$249.95Details


Fogless Shower Mirror with Squeegee by ToiletTree Products. Guaranteed Not to Fog, Designed Not to Fall.

Look your best by taking care of your face in your shower. This patent pending mirror is guaranteed not to fog in the shower.

$34.95Details

Needle, Sword of Arya Stark. Licensed from George R.R. Martin's "A Song of Ice and Fire."

Lighter, thinner, and smaller than a typical Westeros blade, the style was closer to that of Braavos across the Narrow Sea, to be used for thusting and slashing, style of combat more suited to the quick and agile, rather than those with raw strength.

$199.95Details


iHome iHM60LT Rechargeable Mini Speaker (Blue Translucent)

The iHM60 is an amazing approach to audio that offers size defying sound. Speaker connects to a computer or other USB power source via the included USB cable to recharge the internal lithium ion battery.

$19.99Details

Iron Throne Paperweight

Keep your papers secure with this Iron Throne paperweight.

$59.99Details


Game of Thrones Night's Watch Oath Mug

I am the watcher on the walls.

$14.99Details

Game of Thrones Khaleesi Women's T-Shirt

The Game of Thrones Khaleesi t-shirt symbolizes the power the Khaleesi has over the toughest of all warriors.

$24.99Details


Snap Circuits Jr. SC-100

Curious young minds can learn the basics of electronics as they build more than 100 exciting projects with this kit. Work on projects that make sound effects, engineer different types of alarms, build touch circuits and play games.

$18.00Details

Game of Thrones Dragon Egg Necklace

Among Daenerys' most prized possessions are the three petrified dragon eggs gifted to her upon marrying Khal Drogo, immortalized here with the Game of Thrones Dragon Egg Necklace.

$69.99Details


Vinturi Essential White Wine Aerator

Specially designed to aerate white wine and produce better bouquet, enhanced flavors and smoother finish

$42.89Details

Game of Thrones House Lannister Shot Glass

One of the richest and most powerful families of Westeros is honored on this Game of Thrones House Lannister Shot Glass.

$6.99Details


Game of Thrones House Stark Phone & MP3 Player Skins

For a Great House that can claim a line of descent stretching back over eight thousand years, this Game of Thrones House Stark Phone & MP3 Player Skin has a lot to live up to.

$14.99Details

Diablo III

Shut up and take my money Blizzard.

$59.99Details


Game of Thrones Stark Ring

Engraved with the House Stark emblem of a direwolf, the Game of Thrones Stark Ring will let your enemies know where your loyalties lie.

$29.99Details

Game of Thrones Robb Stark T-Shirt

Show your loyalty to the House Stark with the Game of Thrones Robb Stark T-Shirt.

$24.99Details


Star Wars: The Complete Visual Dictionary - The Ultimate Guide to Characters and Creatures from the Entire Star Wars Saga

Provides a complete, comprehensive overview of the Prequel movies (Episodes I-III) and the Trilogy (Episodes IV-VI), this is the definitive photographic guide to the entire Star Wars saga.

$26.40Details

Game of Thrones Khal Drogo T-Shirt

Khal Drogo, powerful Dothraki chieftain and leader of the largest khalasar in the Dothraki Sea, has proven undefeated in Game of Thrones.

$24.99Details


Boba Grafetti baby tee

You should wait for the paint on your helmet to dry before launching head first into a sail barge, it may leave a nasty imprint of your defeat.

$18.95Details

Game of Thrones House Lannister Wall Plaque

Show your allegiance to the Lannisters with a house banner. Fair haired, tall and handsome, the Lannisters are the blood of Andal adventurers who carved out a mighty kingdom in the western hills and valleys.

$34.99Details


Evolution of Evil T-Shirt

There has been a disturbance in the force, and it ain't good.

$19.95Details

House Targaryen Leather iPod Case

A leather iPod Touch case featuring the symbols of House Targaryen embossed on the cover - a three headed dragon raised up in attack.

$35.00Details


Ackbarpography t-shirt

Take a closer look and you'll discover the holy grail of science fiction one-liners... IT'S A TRAP!

$19.95Details

Game of Thrones Bookmark: Jon Snow

This bookmark features Jon Snow and his direwolf, Ghost. It is 2.5"x6", digitally printed on heavyweight paper and UV-coated. Watermark will not appear on the bookmarks.

$3.00Details


Stormtroopa t-shirt

When someone always rescues the princess, when a short stumpy plumber can dismantle an entire evil empire, when all the giant bombs and bullets of the world just aren't enough - it's time to consider the benefits of mass-production!

$19.95Details


Peek into the Dark Side t-shirt

What would you do with the power? We feel a breeze in the Force.

$19.95Details

Iron Man Mark II 12 Inch Deluxe Figure

This is a must for any collector Iron Man in this full body titanium color suit just like thr prototype in the movie.

$999.99Details


Mario Bros.: Koopa Shell Plush and Backpack

You never know when you need a turtle shell.

$39.95Details

Bed Fan

The Bed Fan delivers a cool breeze between the sheets--without AC costs, and without disturbing your partner.

$79.95Details


Syringe Ballpoint Pen

Inject some fun into your writing with this cool pen. It looks just like a syringe, and the pen extends every time you "make an injection."

$1.59Details

Kikkerland UL01 Electro Man 4-Plug Multi-Outlet

Meet a powerful man who is more than a boring power outlet. Perfect for home, school or office, his legs and arms have three-prong sockets with enough room even for the biggest adapter.

$21.00Details


Handtrux Backhoe

HandTrux - when you're ready to play dirty! This amazing handroaulic power grip is a fun backhoe for dirt or sand. Just insert you hand in the sleeve, grab the lever inside the bucket and start digging!

$17.99Details

MANGROOMER Do-It-Yourself Electric Back Hair Shaver

The Mangroomer Do-It-Yourself Electric Back Shaver is absolutely the best way to get rid of unwanted back hair.

$39.99Details


Obol, the Never-Soggy Cereal Bowl

Soggy cereal is a problem of the past.

$19.99Details


Sea to Summit Pocket Shower

Bring an 8 minute shower anywhere you go. Also works as a regular dry sack.

$24.21Details

Monkey Light Bike Light

A revolutionary bike light that keeps you visible! It features 32 of the brightest full color LEDs available, and cutting edge visual effects custom designed by our electronic artists.

$64.99Details


Handcrafted Figured Mahogany Case for iPhone 4/4S

Protect your phone with classic style.

$69.95Details

Kikkerland Skull Shot Glasses, Set of 4

Skull Shot Glasses, do I really need to write more than that?

$11.99Details


Norpro Nonstick Cake-Sicle Pan with 24 Sticks

I wish I had thought of this. Cakesicles. mmmm.... delicious

$19.99Details

Garden Zombie

There's A Zombie On Your Lawn! Nobody was quite sure what caused it. An alien pathogen riding the tail of Halley's Comet? Some government "rage" virus? Radiation from a downed satellite?

$89.99Details


12 Gauge Shot Glass

Fire off a few rounds with our set of 12 Gauge Shot Glasses.

$17.95Details

Cake Pop & Donut Hole Bakery

Make your own donut holes at home!

$24.99Details


Smart Planet CDM-1 Corn Dog Maker

Make your very own corn dogs

$24.99Details

Adjust-A-Cup 2-Cup Measuring Cup

Tired of having to deal with tons of different measurement cups and spoons? This elegant adjustable measuring cup solves everything.

$12.99Details


Silver Robot 8GB Flash Drive

When it comes to file storage, you want something as reliable as your favorite lovable robot.

$44.99Details

MATH CLASS Wall Clock mathematics teacher classroom gift

I probably will never know what time it is again.

$22.99Details


Tailgate Folding Wooden Picnic Table

Have a picnic anywhere with the comfort of your own personal picnic table.

$134.99Details

World's Largest Giant Gummy Bear Cherry

Sometimes I just crave a gummy bear steak.

$29.15Details


Think Geek Star Trek Enterprise Pizza Cutter

Boldly go where no pizza has gone before with Think Geek's Star Trek Pizza Cutter.

$24.99Details

The Slanket Blanket-Moss Green

A blanket that doesn't make you feel trapped.

$49.95Details


iRobot Remote Controlled Cordless Electric Gutter Cleaning Robot

Looj blasts through debris, clogs and sludge and brushes your gutters clean. Stop repeated ladder repositioning and over reaching from dangerous heights.

$129.99Details

Reamde: A Novel

Reamde is a swift-paced thriller that traverses worlds virtual and real. Filled with unexpected twists and turns in which unforgettable villains and unlikely heroes.

$18.99Details


Jailbreak Collective Like and Dislike Stamps (Set)

Preloaded with enough ink for 5,000 assertions, the stamps give you the ability to emphatically thwack your opinion on tangible objects. Judge all the things.

$12.99Details

Wild Planet Lazer Tripwire

Warning alarms alert you to intruders, while 3 lazer units form a perimeter that protects your top secret stuff – just like banks and museums use!

$20.09Details


Chessex Dice: Pound of Dice (Pound-O-Dice) Approximately 100 Die

For only the most extreme board game player or gambler.

$18.85Details

Glow in the Dark Toilet Roll

Don't like turning the light on when you need an impromptu midnight wee? Your aim may be rubbish, but at least you can find the toilet paper thanks to our Glow in the Dark Toilet Roll!

$7.60Details


The Golf Club Incrediball RTR RC Remote Control Golfball (Color May Vary)

A remote controlled golf ball that can be set to spin off in any direction you fancy at the flick of a switch.

$17.99Details

Fred & Friends Beat It Chopsticks Set

One end of each chopstick is a regualr chopstick shape while the other end of of the chopstick is in the shape of a drumstick.

$14.99Details


Hydrofarm HGTL Thirsty Light Original Digital Indoor Plant Moisture Sensor

When a plant's soil becomes dry, the LED on the Thirsty Light blinks to let you know.

$9.15Details

Dynaflex Iron Power Force 1 - Silver, Metal Powerball

The Iron Power Force One Gyro creates up to 16,000 rpm and 50 pounds of silky-smooth dynamic resistance in the palm of your hand.

$99.89Details


Kate Spade iPhone 4 Tropical

This fun striped pattern is done in bold shades of lavender, yellow-gold,blue, fuschia, pink and lime.

$25.00Details

Nerf N-Force Marauder Long Sword - Black

A sword designed for full contact fighting.

$38.77Details


Back to Basics TEM500 Egg-and-Muffin 2-Slice Toaster and Egg Poacher

The Egg & Muffin Toaster brings innovation to the toaster category by combining the functions of a toaster and an egg poacher into one easy-to-use appliance.

$34.00Details

Fish Eyes Rod and Reel with Underwater Video Camera

Underwater camera lets you watch what's happening on the line.

$59.99Details


3-D Mirascope

This super-cool toy creates a realistic 3D Holographic image from small objects, for hours of family fun.

$4.74Details


Extremely Loud and Incredibly Close MTI: A Novel

Nine-year-old Oskar Schell has embarked on an urgent, secret mission that will take him through the five boroughs of New York.

$9.96Details

(4gb MicroSD Bundle) US Mint 1/2 Dollar - Micro SD Card Covert Coin - Secret Compartment

Spy coin helps you turn every day objects into a secret compartment.

$34.99Details


Better Sleep Pillow - A Multi Position Pillow for Side Sleepers, Stomach Slee...

Now you can enjoy the benefits of the most comfortable multi-functional doctor-approved pillow.

$99.99Details

Sphere Pen Camera - Hidden Video Spy Pen

1.5 hours of high quality video stored on 4GB memory card.

$99.99Details


Shower Shock Caffeinated Soap

the original and world's first caffeinated soap from ThinkGeek. When you think about it, ShowerShock is the ultimate clean buzz ;)

$6.99Details

Helter Skelter Drinks Chiller

Warm drinks are so 20th century.

$33.18Details


Tea Sub - Yellow Submarine Tea Infuser

We all live in a yellow submarine, a yellow submarine,a yellow subm...

$10.81Details

Lush Life Party Ice Luge

Let the fun begin when your pour your favorite drink down the luge.

$22.50Details


Wild Planet Lazer Tripwire

Warning alarms alert you to intruders, while 3 lazer units form a perimeter that protects your top secret stuff just like banks and museums use!

$19.92Details

Iron Man 2 Macbook Decal Mac Apple skin sticker

A wise man once asked, Is it better to be feared or respected? I say, is it too much to ask for both?

$15.99Details


Game of Thrones World Map

Map of Westeros, Essos & Valyria.

$20.00Details

Got Wood?

T-Shirt (Also available as Hoodie)

$24.54Details


Game of Thrones

Soundtrack from Game of Thrones

$15.34Details

Creeper Mousepad

You'll receive one cloth topped mousepad that is backed with non-slip, non-marking rubber.

$12.00Details


Game of Thrones Patches, Song of Ice and Fire, FULL SET

These patches features my interpretation of the coats of arms of the six major houses from George R. R. Martin's "A Song of Ice and Fire" series -- Stark, Lannister, Baratheon, Targaryen, Greyjoy, and Tully.

$48.00Details

Minecraft Diamond Ring

The ring is adjustable, and the figure is made from Polymer clay. It is painted with acrylic paint and finished with Min-Wax polycrylic to seal and protect it.

$10.00Details


The George R.R. Martin Song Of Ice and Fire Hardcover Box Set featuring A Game of Thrones, A Clash of Kings, A Storm of Swords, and A Feast for Crows (Amazon Exclusive)

George R. R. Martin has created a world that is as rich and vital as any piece of historical fiction, set in an age of knights and chivalry and filled with a plethora of fascinating, multidimensional characters that you love, hate to love, or love to hat

$86.31Details

Minecraft inspired Grass Cube Tissue Box Cover

Save your desk or nightstand from those ugly cardboard tissue boxes!

$18.00Details


A Dance with Dragons: A Song of Ice and Fire: Book Five

In the aftermath of a colossal battle, the future of the Seven Kingdoms hangs in the balance once again--beset by newly emerging threats from every direction.

$17.48Details


Steampunk Ring - Game of Thrones Inspired Eye of the Dragon Wire Wrapped Lampwork

Steampunk is so inspiring and original. I love the twists and turns in these rings. Every ring is one of a kind with Custom Artisan Lampwork Boro Glass Beads. The artist that creates them is a great friend of mine and is so knowledgeable about glass work

$45.00Details

Minecraft Diamond Earrings

Advertise your love for Minecraft with these rare gems! Here is a pair of gorgeous diamond earrings, straight from the depths of my private mine. Diamonds *are* a miner's best friend.

$10.00Details


A Song of Ice and Fire 2012 Wall Calendar

A Song of Ice and Fire Wall Calendar: With stunning all-original artwork from John Picacio-one of the genre's most popular artists.

$14.99Details

3D Pig from Minecraft

Oink! Oink!

$20.00Details


Minecraft Diamond Tool/Weapon Magnet Set

Each magnet has at least one strong round magnet or bar magnet so they're not only fun but functional. See my shop for other Minecraft sets, including this one in iron and gold.

$10.00Details


Minecraft University Hoodie

Ad Gloriam et Porcos (For pigs and glory!)

$59.99Details


Moon of My Life - Swarovski Crystal AB Necklace

This necklace is inspired by words of endearment of Khal Drogo for Daenarys in George R. R. Martin's Game of Thrones, first book in the Song of Ice and Fire series.

$31.00Details

Minecraft Note Cube

Leaves no cobblestone residue once fully mined

$14.95Details


Winter is coming - Game of Thrones Unisex Cuff Bracelet

The hammered copper is accented by a rectangle of sterling silver that is stamped with the House of Stark motto "Winter is coming" from the George Martin Song of Ice and Fire series. The bracelet is then oxidized to give it a distressed look.

$45.00Details

Minecraft Sheet Magnets

80 1" square blocks on each sheet (2 sheets)

$21.53Details


Game of Thrones 11x17 HD Photo Poster HBO Tv Series #05

Tyrion Lannister (Peter Dinklage) Game of Thrones poster.

$11.99Details

Minecraft Drop it Creep Premium Tee S

A Creeper bounces his way up to an unsuspecting clerk, Give me all your money, bookworm, or I blow up your brainssssSSSsss!

$21.99Details


Fierce as a Wolverine - Arya Stark Aluminum Cuff Bracelet

It is hammered on the edges and ends and stamped with one of Arya Stark's Braavosi mantras--"fierce as a wolverine"--from Game of Thrones, the first in the fantasy series "Song of Ice and Fire" by George R. R. Martin. The text is

$21.00Details

Minecraft Foam Pickaxe

The Minecraft Foam Pickaxe is made from sturdy EVA foam, which means that unlike the stone pickaxe in the game, the Minecraft Foam Pickaxe will withstand far more than 132 uses.

$49.99Details


Apple Macbook Laptop Game of Thrones Stark Decal

Apple Macbook Game of Thrones Stark Decal

$7.99Details

Minecraft Creeper Anatomy T-Shirt

The Creeper (Creepus explodus) is an all-terrain combustible terror of destruction, indigenous to dark caves found deep beneath the earths crust, and luxurious neighborhoods with glass houses and nice fancy everythings.

$19.99Details


Game Of Thrones Movie Poster 24x36in

Game of Thrones Poster Print

$19.97Details

Minecraft Confused Shirt

We presume that to a denizen of Minecraft spheres would be sort of like what non-Euclidean geometry is to us.

$19.99Details


Minecraft Creeper T-Shirt

Embrace your inner Creeper!

$19.99Details



Game of Thrones Art Print - Stick 'Em With The Pointy End

What's the first lesson of sword fighting? This print was inspired by everyone's favorite little mischief maker, Arya Stark. It features the Stark house colors, grey and white with an image of Needle at the top.

$15.00Details


Game of Thrones: The Complete First Season

Game of Thrones Season 1 DVD

$44.99Details

Sir Creeper of Minecraftia

Sir Creeper is a lover of all things expensive, and your newly acquired diamond is looking really good to him right now.

$24.54Details


A Game of Thrones: The Card Game

The A Game of Thrones card game can be played in a multiplayer melee format with 3-4 players, or in a one-on-one joust format with 2 players.

$22.49Details

Don't Fear the Creeper (Sticker)

There's nothing to fear, all he has is an explosive personality!

$2.40Details


A Game Of Thrones

With this fantastic board game, players can enter the world of George R. R. Martin's best-selling A Song of Ice and Fire fantasy series and take control of one of the great houses of Westeros. Using warfare, diplomacy, and treachery, players vie for

$59.99Details

Skull & Pickaxes (Sticker)

The traditional Skull & Crossbones with an added Minecraft twist!

$2.40Details


Peekaru Original Fleece Baby Carrier Cover Medium - Black

Share the warmth with your baby or toddler. The Peekaru Original is an environmentally friendly fleece vest that fits over you and your baby, keeping you both warm without giving up the comfort of your favorite baby carrier.

$79.95Details

Flip UltraHD Video Camera

Taking HD video has never been so easy or portable! Flip HD lets you capture every moment with dazzling quality without breaking the bank.

$129.00Details


Kids Raptor Hoodie Shirt

If it wasn't for a giant meteor, dinosaurs would be living in cities instead of us. Honor those proud killing machines by wearing the Raptor hoodie. Go from docile dino to fearsome raptor in seconds.

$24.99Details


Clear Blue Hawaii Molokini 2 - Person Kayak

Transparent Molokini Kayak. Discover. Explore. See. Witness fascinating lake or sea life through the sleek transparent hull. This is a great investment whether your goal is serious research or a child's voyage of discovery.

$2,243.17Details

Sub Zero Macbook Decal Mac Apple skin sticker

Make your Mac Book go Sub-Zero in coolness.

$15.99Details


About Face 3: The Essentials of Interaction Design

This completely updated volume presents the effective and practical tools you need to design great desktop applications, Web 2.0 sites, and mobile devices. This book will teach you the principles of good product behavior.

$45.00Details

Don't Make Me Think: A Common Sense Approach to Web Usability, 2nd Edition

100,000 copies sold. If you do anything web related, this book is a must read.

$40.00Details


Cute Fire Extinguisher Lighter With LED Light

Irony is always in style, right? Light up with this extinguisher.

$9.00Details

The Design of Everyday Things

Anyone who designs anything to be used by humans--from physical objects to computer programs to conceptual tools--must read this book, and it is an equally tremendous read for anyone who has to use anything created by another human.

$15.95Details


Electronic Guitar Shirt

You air guitar getting old? Step up your game with this rockstar guitar tshirt with built in mini amp.

$19.99Details

Official Barney Stinson Armani Grey Suitjamas

A salute to the perfect gentlemen. Never not wear a suit again!

$99.99Details


Bear Grylls Survival Series Ultimate Kit

The product of collaboration between Gerber and survival expert Bear Grylls, the Ultimate Kit is a 15-piece survival kit built for hostile environments.

$67.50Details

Portable Amp For Iphone Horn Stand White

Turn up the sound with science (and not your battery)

$24.99Details


All My Friends Are Dead

All My Friends Are Dead presents a delightful primer for laughing at the inevitable.

$9.95Details

Bamboo Wirelesskeyboard & Mouse

Environmentally friendly keyboard and mouse combo

$142.09Details


Big Mouth Toys Toilet Mug

A toilet bowl full of brown liquid, that's just tasteless. Or funny.

$10.97Details


Bath Tissue Tyrant: Commode Dragon

Some dragons are helpful. Rest peacefully knowing this dragon is guarding the most important thing in the room.

$34.95Details

Nostalgia Electrics SCM-502 Vintage Collection Old Fashioned Snow Cone Maker

This old-fashioned, carnival-style snow cone maker cart shaves ice cubes into snow. Add your choice of flavored syrup. Now you can enjoy the wonderful cool taste of Snow Cones anytime in the convenience of your own home.

$67.00Details


Gear Wall Art with Clock

Perfect for the mechanically inclined person in your life. Perfectly balanced between art and utility.

$140.00Details

Swinging Sticks Kinetic Energy Sculpture

The Swinging Sticks Kinetic Energy Sculpture is a high end, museum quality moving display that is ideal for offices, lobbies, waiting rooms, and conference rooms.

$229.99Details


8 Bit Tie

A reminder of better days.

$14.99Details

USBCELL AA Rechargable Battery

Can't find your charger? USBCELL AA Rechargeable Batteries work just like normal rechargeable batteries--but simply pop off the lid to recharge by any powered USB Port.

$19.95Details


BACON shaped themed Adhesive Bandages

Bacon Band Aids. Bacon really does fix everything.

$6.99Details


Adult R2-D2 Star Wars Beanie

Crocheted R2-D2 beanie hat for teens and adults.

$42.00Details

Ultra-Star 175G Ultimate Disc

The world standard for the sport of Ultimate, and the official disc of the USA Ultimate Championship Series.

$5.95Details


Step 2 Up & Down Roller Coaster

Let your child experience the up-and-down thrills of a roller coaster in the safety of your living room or driveway with the Up and Down Roller Coaster

$94.88Details


Cards Against Humanity

Cards Against Humanity is a party game for horrible people. Unlike most of the party games you've played before, Cards Against Humanity is as despicable and awkward as you and your friends.

$25.00Details


Britax Frontier 85 Combination Booster Car Seat, Rushmore

The new Britax frontier 85 combination harness 2 booster boasts best in class forward-facing five-point harnessed weight capacity up to 85 pounds with an industry-leading 20" shoulder harness height.

$212.49Details

Camelbak M.U.L.E. 100 oz Hydration Pack, Chili Pepper/Charcoal

The M.U.L.E. NV from Camelbak is a narrow-gauge pack for 3+ hours of all-terrain adventures in any weather.

$69.98Details


Eagles Nest Outfitters DoubleNest Hammock (Orange/Grey)

The DoubleNest seats more than one person comfortably and is essential for family adventures. The DoubleNest still packs down to the size of a grapefruit, so there is no excuse to be without your ENO hammock.

$64.95Details

Star Wars X Wing Pilot Hoodie

This Star Wars X-Wing Pilot Hoodie is specifically customized to reflect Luke Skywalker's jumpsuit, visor and specific helmet designs.

$150.00Details


Star Wars Darth Vader Helmet

Are you ready to feel like the villain to end all villains This detailed DARTH VADER electronic helmet will make the action feel incredibly real!

$19.97Details



Custom HAND Painted Heels - Star Wars

THE VERY BEST CUSTOM STAR WARS HEELS YOU WILL FIND!

$275.00Details

Star Wars Art Prints Boba Fett R2D2 and C-3PO Art 3D Pop Artwork Droid Art

This Star Wars Art prints listing is for paper cut 3-D pop artwork featuring the galaxy's favorite bounty hunter Boba Fett and inter-galactic best buddies: R2-D2 and C-3PO.

$67.00Details


LEGO Star Wars Millennium Falcon 7965

Straight from the Death Star escape scene of Episode IV: A New Hope

$126.99Details

Funko Darth Vader Bobble - Head

This mighty warrior will watch over your desk and enforce the emperor's will on all who dare draw near.

$10.07Details


STAR WARS DOG hat costume yoda

Show your love of awesome things by dressing your furry monster up as Yoda this year!

$20.00Details

Presto 03430 Pizzazz Pizza Oven

The fast and easy way to bake fresh or frozen pizza. Great for frozen, homemade, take-and-bake, or deli pizza. The easy way to prepare chicken nuggets, quesadillas, fish fillets, even grilled sandwiches.

$39.96Details


Carhartt Men's Thermal Lined Duck Active Jacket, Brown, Large Regular

Work proven, our duck active jacket is built with 12-ounce, firm-hand, 100% ring-spun cotton duck with a 100% polyester thermal lining for on-the-job warmth.

$69.99Details

Pelican 1170 Carrying Case for Multi-Purpose - Black

Hand-held electronics protection solution. Watertight, crushproof, and dust proof. Easy open Double Throw latches. Open cell core with solid wall design - strong, light . O-ring seal. Automatic Pressure Equalization Valve. Pick N Pluck with convoluted li

$34.24Details


LeapFrog Fridge Farm Magnetic Animal Set

Moo! Oink! Bow-wow! Toddlers from one to five years old will love making wacky animal combinations with this LeapFrog Magnetic Animal set.

$15.87Details

iRobot 530 Roomba Vacuuming Robot, White

This specific Roomba model systematically cleans up to three* rooms on a single charge and gets into hard-to-reach wall edges and beneath furniture, while avoiding stairs and other drop-offs.

$249.99Details


Magic Bullet MBR-1701 17-Piece Express Mixing Set

The magic bullet replaces a food processor, blender, and coffee grinder. Yet it occupies only the space of a coffee mug.

$38.49Details

Vtech Kidizoom Plus Digital Camera - Blue

Little ones will have a blast taking candid pics with their Kidizoom Camera. Kidizoom includes a connector cable to plug in and watch a picture slideshow or view the 5-minute movies they've created on any TV or PC.

$89.99Details


Spirited Away

SPIRITED AWAY is a wondrous fantasy about a young girl, Chihiro, trapped in a strange new world of spirits. When her parents undergo a mysterious transformation, she must call upon the courage she never knew she had to free herself and return her family

$23.49Details

Sony ICFS79W AM/FM/Weather Band Digital Tuner Shower Radio (White)

Listen to your favorite shows while you shower.

$52.58Details


Adagio Teas 16-Ounce Ingenuitea Teapot

Great for the office or when traveling, this innovative teapot releases infused tea into a drinking cup. When tea is ready, simply place it atop the cup, causing a valve at the bottom to release and crystal-clear tea to flow down.

$17.45Details

Marini's Candies Chocolate Covered Bacon 1/2 lb. Gift Box

Hickory smoked bacon is cooked in the oven until golden & crisp then it's smothered in milk chocolate.

$12.95Details


Cuisinart GR-4N 5-in-1 Griddler

Compact in size but big in features, Cuisinart's countertop Griddler offers five-in-one functionality as a contact grill, panini press, full grill, full griddle, and half grill/half griddle.

$80.25Details

Doctor Who 11 Doctors 5" Action Figure Collector Set

This boxed set features 5 inch figures of the eleven men to portray the Doctor in the BBC series, with new costumes and new sculpts.

$99.99Details


MIU France Zinc Alloy Connoisseur Corkscrew Wine Opener

The next best thing to an in-house sommelier, this professional-quality wine opener offers the same impressive performance and stylish design as corkscrews that cost far more.

$20.99Details

Hand Held Scalp Head Massager - Set of Three ( Colors May Vary )

It relieves tension as it softly massages acupressure points and stimulates sensitive nerves in your scalp.

$19.99Details


Melissa & Doug Deluxe Magic Set

Amazing multi-piece sets feature amusing illusions and crafty slight-of-hand tricks for the young magician to practice and perform.

$26.29Details

Gerber 31-000751 Bear Grylls Survival Series Ultimate Knife, Serrated Edge

Intricately designed by Gerber and Bear, it's loaded with innovations that won't be found in any other fixed blade knife. Like everything in the Survival Series, it also includes Bear's Priorities of Survival pocket guide.

$42.13Details


StarCraft II: Heart of the Swarm (Pre-Order)

Heart of the Swarm expansion for Starcraft 2

$59.99Details

Transformer USB Flash Memory Drive 4GB

This USB drive transforms from Leopard to USB stick in seconds.

$9.80Details


Razer Marauder StarCraft II Gaming Keyboard

The Razer Marauder StarCraft II gaming keyboard is a full featured, tournament ready keyboard with an extremely compact design.

$98.35Details

TOTO Washlet - Temperature Controlled Toilet Seat

Cold Toilets are so yesterday.

$409.86Details


Razer Banshee StarCraft II Gaming Headset

With its circumaural design the Razer Banshee is designed for optimal sound isolation to allow you to focus completely on your game.

$100.23Details

Razer Spectre StarCraft II Gaming Mouse

Razer Spectre StarCraft II gaming mouse is a lightweight, five button mouse that is ideal for gamers that prefer precision and control for an RTS.

$63.11Details


Razer StarCraft II Zerg Edition Messenger Bag

The Starcraft II Zerg Edition Messenger Bag is designed for gamers who want to keep their gear protected, stay comfortable, and look good doing it.

$59.77Details


Starcraft II 2 Dog Tag USB 2gb drive James Jim Raynor

Starcraft 2 Dogtag USB Stick ensures you're the coolest kid at the lan party.

$90.00Details

The StarCraft Bible 2nd Edition: Who knew that explosions of pixels could inspire?

This is the history of StarCraft. This is the love of e-sports. This is the Bible of StarCraft.

$16.99Details


Something to Read on the Plane

A delightfully light-hearted variety of stories, articles, limericks, and even a quiz to see how good a passenger you are.

$0.99Details

Pwned Mug

PWNED.

$9.99Details


Munchkin Mozart Magic Cube

A true breakthrough in music education, the Munchkin Mozart Magic Cube will be music to your baby's ears.

$15.00Details


Handmade Star Wars Chewbacca Stuffed Plush Animal

Carry Chewie where ever you go! 20 inches tall with cute button eyes and a cute button nose! Handmade out of the softest fluffiest brown fur availabel! Comes with bandolier.

$28.00Details



Kotobukiya Star Wars: Han Solo in Carbonite Silicon Tray

Freeze your own Han Solo! Here comes an innovative Star Wars kitchen product from a galaxy far, far away. This time around, the fun gets frosty with the Han Solo in Carbonite Silicone Tray.

$8.89Details

Boba Fett Star Wars Hat

Now you too can be digested by the Sarlac Pit Monster!

$49.99Details


Star Wars Ultimate Darth Vader FX Lightsaber

Act just like Darth Vader with the Darth Vader Star Wars Ultimate FX Lightsaber, a glowing, humming, clashing Lightsaber that looks and feels just like the real thing.

$38.99Details

Star Wars - Movie Poster (Darth Vader: Your Empire Needs You) (Size: 24" x 36")

Star Wars Movie Your Empire Needs You Darth Vader Poster Print - 24x36

$7.99Details



Underground Toys Star Wars 9" Talking Plush - Chewbacca

This Classic talking Star Wars recreation of absolutely everyone's favorite Wookie, is incredibly cute and life like!

$25.08Details

Star Wars Deluxe Set of 6 Movie Posters From ALL the Star Wars Movies

6 STAR WARS MOVIE POSTERS on Quality Stock Paper One full size movie poster from each Star Wars Episode.

$32.99Details


Underground Toys Star Wars 9" Talking Plush - R2-D2

Why not take a load off and cuddle up with this wonderful, talking, soft plushes while war rages on between the Empire and the Rebel forces!

$22.34Details


Star Wars "Men of Distinction" set of two 11x17 prints (Darth Vader & Boba Fett), unframed

Have you ever wished for Star Wars-related art with class and distinction? Look no further; this dark lord and bounty hunter duo knows how to settle things like true gentlemen.

$20.00Details

Star Wars: The Clone Wars - The Complete Season One

This new TV series takes place immediately after the events of Star Wars-Episode II: Attack of the Clones.

$44.98Details


Star Wars 10 oz Glasses, Set of 4

1 each of Princess Leia, Darth Vader, Luke Skywalker, and Han Salo

$25.00Details

Fanboys

Get ready for the comedy adventure that's "smart, funny, and tailor-made for the inner-Jedi in all of us"

$6.49Details


Vandor 18-Ounce Ceramic Mug, Star Wars Yoda

You don't need to travel to a galaxy far, far away to find your favorite classic Star Wars characters.

$19.26Details


Kurt Adler SW6101L Star Wars Nutcracker, Storm Trooper, 11-Inch

This 11-inch nutcracker is based on a Storm Trooper from the popular Star Wars series.

$35.67Details

Lego Star Wars: The Complete Saga

Play through the events of all 6 Star Wars movies in 1 videogame for the first time ever.

$17.29Details



Stormtrooper Regrets T-Shirt

Those WERE The Droids You Were Looking For

$16.99Details

Star Wars Dinnerware Plate and Bowl - 2 Piece Set

Package includes 1 plate and 1 bowl Plate size 8 inches in diameter, bowl size is 5.75 inches in diameter.

$4.51Details


Meon Star Wars - Interactive Animation Studio

Make your own Star Wars animated signs that light up like Neon.

$11.99Details

Vandor 14 by 4 by 15-Inch Star Wars Large Recycled Shopper Tote, Multicolored

The Star Wars Large Recycled Tote is the perfect gift for any Star Wars fan.

$5.95Details


Revell Star Wars -Millennium Falcon

Perhaps the most iconic starship in the universe.

$35.61Details

Flared Star Wars Skirt

One of a kind Skirt. Flared Style. With Knit Waistband. M Waist 30-38

$25.00Details


Star Wars Cupcake Stencils

Our set includes Star Wars logo, Darth Vader, Yoda and a Stormtrooper

$19.99Details

Star Wars Lightsaber USB Glow Lamp

USB Light Saber Lamp

$31.00Details


Star Wars: Episode I-VI - Movie Poster (All Characters - With Space Ships) (Size: 36 x 24) Poster Print, 34x22

Star Wars: Episode I-VI - Movie Poster (All Characters - With Space Ships) (Size: 36 x 24)

$2.82Details

Framed Star Wars YODA best quotes text print

This is a limited edition TEXT art piece. The image is made up entirely of colored text.

$19.99Details


Star Wars Clone Wars Comforter - Twin

Star Wars Clone Wars Comforter.

$34.83Details

© Gift Lizard 2011