×

Find gifts by describing the person you are trying to buy for. Use things like who they are (dad), their hobbies (star wars), their personality (geek, gamer).

You searched for: dadgeekgamergirlfriendgirlsfireflyartsywomenteenselectronicshomepetsstargatecooking

Reset Tags. (Click a tag to remove it. Add tags on the left side.)

Lilly Pulitzer iPad & Netbook Sleeve - Nice To See You

Protect your iPad/NetBook in style.

$29.95Details

Kindle Fire, Full Color 7" Multi-touch Display, Wi-Fi

Kindle Fire isn't just for books anymore. Web, Apps, Video, Magazines, Music and More!

$199.00Details



Kate Spade iPhone 4 Tropical

This fun striped pattern is done in bold shades of lavender, yellow-gold,blue, fuschia, pink and lime.

$25.00Details

Sweet Valley Confidential: Ten Years Later

Jessica and Elizabeth Wakefield are back and all grown up, dealing with the complicated adult world of love, careers, betrayal, and sisterhood.

$8.80Details


Hand Held Scalp Head Massager - Set of Three ( Colors May Vary )

It relieves tension as it softly massages acupressure points and stimulates sensitive nerves in your scalp.

$19.99Details

Pleo Dinosaur - A UGOBE Life Form

Pleo looks, moves, sounds and behaves like a living creature. Fully aware and cognitive, he explores his environment and interacts with people, accessories and other UGOBE dinosaurs.

$508.08Details


Transformer USB Flash Memory Drive 4GB

This USB drive transforms from Leopard to USB stick in seconds.

$9.80Details

Cuisinart GR-4N 5-in-1 Griddler

Compact in size but big in features, Cuisinart's countertop Griddler offers five-in-one functionality as a contact grill, panini press, full grill, full griddle, and half grill/half griddle.

$80.25Details


Swiss+Tech UKCSB-1 Utili-Key 6-in-1 KeyChain MultiTool

The lightest and most compact multi-use tool ever developed.

$7.50Details

Numi Organic Tea Flowering Gift Set in Handcrafted Mahogany Bamboo Chest: Glass Teapot & 6 Flowering Tea Blossoms

Packaged in an exotic hand-made dark mahogany bamboo case, this Flowering Gift Set is filled with six bouquets of tea leaves that blossom into a myriad of flavors from sweet and subtle to rich and bold.

$21.75Details


Presto 03430 Pizzazz Pizza Oven

The fast and easy way to bake fresh or frozen pizza. Great for frozen, homemade, take-and-bake, or deli pizza. The easy way to prepare chicken nuggets, quesadillas, fish fillets, even grilled sandwiches.

$39.96Details

Adagio Teas 16-Ounce Ingenuitea Teapot

Great for the office or when traveling, this innovative teapot releases infused tea into a drinking cup. When tea is ready, simply place it atop the cup, causing a valve at the bottom to release and crystal-clear tea to flow down.

$17.45Details


Bling Jewelry Sterling Silver Turquoise Five-strand Bracelet [Jewelry]

Five strands of hand-strung turquoise nuggets are attached to a .925 sterling silver bar clasp.

$39.99Details

PostSecret: Extraordinary Confessions from Ordinary Lives

A global phenomenon, exposing our individual aspirations, fantasies, and frailties -- our common humanity.

$17.68Details


Bling Jewelry Sterling Silver Elongated Teardrop Bangle Bracelet

This bracelet is great for every day wear and elegant for dressy affairs.

$49.99Details

Stainless Steel Aqua Resin Dome Ring

Beautiful Stainless Steel Aqua Resin Dome Ring

$31.99Details


Back to Basics TEM500 Egg-and-Muffin 2-Slice Toaster and Egg Poacher

The Egg & Muffin Toaster brings innovation to the toaster category by combining the functions of a toaster and an egg poacher into one easy-to-use appliance.

$34.00Details

Sense and Sensibility

Jane Austen's most famous novel. It's about the necessity of finding a workable middle ground between passion and reason.

$9.99Details


Anna Karenina

There is no doubt that Anna Karenina, generally considered Tolstoy's best book, is definitely one ripping great read.

$24.99Details

Indian Healing Clay - 2 lbs - Clay

Aztec Secret Indian Healing Clay deep cleanses skin pores, removing dirt and impurities, lifting out poisons and toxins stored in the epidermis.

$7.52Details


Madame Bovary

A story of a woman trapped in a loveless marriage in 19th century France.

$18.49Details

The Portrait of a Lady (Penguin Classics)

A story of intense poignancy, Isabel's tale of love and betrayal still resonates with modern audiences.

$12.00Details


Magic Bullet MBR-1701 17-Piece Express Mixing Set

The magic bullet replaces a food processor, blender, and coffee grinder. Yet it occupies only the space of a coffee mug.

$38.49Details

Vera Bradley Convertible Kisslock in Lemon Parfait

A wallet by day and a purse by night, this convertible accessory is fun, flirty and large enough to hold a Smartphone.

$27.95Details


Just Kids

Just Kids begins as a love story and ends as an elegy. It serves as a salute to New York City during the late sixties and seventies and to its rich and poor, its hustlers and hellions. A true fable, it is a portrait of two young artists' ascent, a p

$10.88Details

Metal Jewelry Stand Tree with an Antique Silver & Gold Finish

Iron Jewelry Tree Stand Unique tree design with leaves and branches Done in an antique silver/gold finish Works great for necklaces and bracelets and has 40 hanging positions

$23.99Details


Better Sleep Pillow - A Multi Position Pillow for Side Sleepers, Stomach Slee...

Now you can enjoy the benefits of the most comfortable multi-functional doctor-approved pillow.

$99.99Details

Aperture Science Mug

Welcome to Aperture Laboratories, A Trusted Friend in Science!

$12.99Details


Shower Shock Caffeinated Soap

the original and world's first caffeinated soap from ThinkGeek. When you think about it, ShowerShock is the ultimate clean buzz ;)

$6.99Details

Michael Kors Perfume for Women 1 oz Eau De Parfum Spray

Creamy florals explode into exotic spices, tamed by Moroccan incense. A fragrant creation with a wealth of personality that will capture the heart of every woman.

$69.99Details


Flowerbomb by Viktor & Rolf for Women - 3.4 Ounce EDP Spray

Launched by the design house of Viktor & Rolf.

$109.14Details

Trish Mcevoy No. 9 Blackberry & Vanilla Musk

TRISH MCEVOY NO. 9 BLACKBERRY & VANILLA MUSK by Trish McEvoy

$48.00Details


Adjust-A-Cup 2-Cup Measuring Cup

Tired of having to deal with tons of different measurement cups and spoons? This elegant adjustable measuring cup solves everything.

$12.99Details

Flawless Sterling Silver Floating Heart, 13/16" X 13/16"

Beautiful Floating heart. Solid Sterling Silver, Excellent mirror like finish.

$79.95Details


Satya Jewelry Silver Turquoise, Hamsa, Lotus Charm Necklace

Turquoise, the stone of healing, and the Hamsa which protects against negative energies, meet the lotus as a symbol of renewal and transformation.

$98.00Details

Think Geek Star Trek Enterprise Pizza Cutter

Boldly go where no pizza has gone before with Think Geek's Star Trek Pizza Cutter.

$24.99Details


Wookiee Cookies: A Star Wars Cookbook

Tusken Raider Taters, Yoda Soda, C-3PO Pancakes... mmmm sounds delicious!

$18.99Details


Boyfriend Pillow

Want to cuddle but nobody is around? The boyfriend pillow will hold you, every night, all night.

$60.00Details

Nintendo Wall Graphics - Super Mario Bros

Level up your room with this Mario Themed wall graphics.

$74.95Details


Super Mario Time to Team Up 50-by-60-Inch Microraschel Throw Blanket

Mario and Luigi race to save the game surrounded by icons and characters from your favorite video game. Cuddle up in this warm throw for a long day of video game fun.

$29.99Details

Thermos Stainless King SK1005MB4 16-Ounce Leak-Proof Travel Mug, Midnight Blue

The ultra-durable, leak-proof Thermos Stainless King travel mug features an unbreakable stainless steel interior and exterior, making it a great companion for use in rough-and-tumble situations such as construction sites, delivery work, and more.

$19.43Details


PUR 18 Cup Dispenser with One Pitcher Filter DS-1800Z

Keep your water clear of chemicals and odors with this dispenser from PUR. Its advanced filtration system reduces more contaminants (lead, copper, zinc, etc.) than any other pour-through filter.

$27.81Details

Carhartt Women's Sandstone Sierra Jacket/Sherpa-Lined,Black,Medium

Our sandstone sierra jacket is sherpa-lined for added warmth. It's made of 12-ounce, 100% cotton sandstone duck and features princess back seams for a premium fit, built-in bi-swing for ease of movement, interior rib-knit storm cuffs, two inside poc

$89.68Details


iMPROV Electronics 8.5" Boogie Board Tablet

You can utilize this writing tablet for home, office or school activity and you will never need a paper or pencil again.

$34.95Details

TOTO Washlet - Temperature Controlled Toilet Seat

Cold Toilets are so yesterday.

$409.86Details


Ten One Design Fling Game Controller - Ninja

Fling is a tactile game controller for iPad.

$9.50Details

Mindflex Duel Game

Mindflex Duel is the ultimate head-to-head brain game challenge

$74.99Details


Learning Resources Zoomy Handheld Digital Microscope

Amazing all-in-one digital microscope takes scientific inquiry to a new level - yet is easy for even a young child to use.

$59.95Details

Manhattan

Manhattan is a wry, touching and finely rendered portrait of modern relationships against the backdrop of urban alienation.

$14.49Details


iRobot 530 Roomba Vacuuming Robot, White

This specific Roomba model systematically cleans up to three* rooms on a single charge and gets into hard-to-reach wall edges and beneath furniture, while avoiding stairs and other drop-offs.

$249.99Details

Bodum Brazil 8 cup French Press Coffee Maker, 34 oz, Black

Bodum Brazil offers a classic take on modern, functional design that will never go out of style.

$16.99Details


Wii Classic Controller Pro - Black

Created for accessibility and comfort, the Classic Controller Pro blends design elements from game systems such as the NES, Super NES, and Nintendo 64 providing seamless play control for a wide range of games.

$19.99Details

Sterling Silver Peridot, Garnet, Amethyst, Blue Topaz and Citrine Individually Boxed Stud Earring Set

Add sparkle and variety to your wardrobe with this set of five individually boxed sterling silver stud earrings, showcasing five different colored gemstones.

$41.99Details


Pantone Universe Mug Violet 7672

The PANTONE UNIVERSE mugs by Whitbread Wilkinson are made with fine bone china.

$15.95Details

Sea Kelp / Moss with Chamomile Herb and Cocoa Butter Soap

The seaside scent in this natural beauty facial and body soap coupled with the invigorating hint of cocoa butter will make you feel like you are relaxing by the ocean.

$9.50Details


Evolution Robotics Mint Automatic Hard Floor Cleaner, 4200

The Mint Automatic Floor Cleaner from Evolution Robotics is designed exclusively for sweeping and mopping hard surface floors for you.

$198.00Details

Silk Nightgown and Robe Set - Royal Peacocks

The robe, on the back, features a pair of majestic peacocks perched on a tree brimming with deep red autumn colors. The painting flows into the front of the robe as well as the gown.

$159.00Details


Weber 386002 Q 100 Portable Propane Gas Grill

The grill ignites at the push of a button for reliable lighting, and an infinitely adjustable burner valve with a high-quality regulator makes it easy to control the heat.

$134.24Details

Sigma Beauty Flat Top Synthetic Kabuki - F80

This exclusive Flat Top Synthetic Kabuki was designed to deliver a flawless makeup application.

$23.38Details


iHome iHM60LT Rechargeable Mini Speaker (Blue Translucent)

The iHM60 is an amazing approach to audio that offers size defying sound. Speaker connects to a computer or other USB power source via the included USB cable to recharge the internal lithium ion battery.

$19.99Details

Satechi CR -3600 car holder mount for iPhone 4S, 4, 3G & 3GS, BlackBerry Torch, HTC EVO, DROID, Samsung EPIC on Windshield and Dashboard

Using a smartphone as a GPS? Mount it in your car properly just like a traditional GPS.

$29.99Details


Midnight in Paris

This is a romantic comedy set in Paris about a family that goes there because of business, and two young people who are engaged to be married in the fall have experiences there that change their lives. It's about a young man's great love for a

$17.99Details


Elephant Ring Holder - Silver

Store your rings on this adorable elephant's trunk.

$24.99Details

Annie Hall

Annie Hall is one of the truest, most bittersweet romances on film.

$10.49Details


1888 Mills Luxury Cotton Made in Africa Bath Towel, White

Super soft bath towel from African cotton with sales contributing to reducing poverty in Africa.

$16.03Details

Mrs. Dalloway / A Room of One's Own

One of Virginia Woolf's greatest novels paired with an influential essay on the role of women in society.

$14.81Details


Orlando (Wordsworth Classics)

Virginia Woolf's Orlando 'The longest and most charming love letter in literature', playfully constructs the figure of Orlando as the fictional embodiment of Woolf's close friend and lover, Vita Sackville-West.

$4.99Details

Drinkwell Platinum Pet Fountain

Pet water fountain.

$44.06Details


Hydrofarm HGTL Thirsty Light Original Digital Indoor Plant Moisture Sensor

When a plant's soil becomes dry, the LED on the Thirsty Light blinks to let you know.

$9.15Details

Can You Imagine 2320 Melting Clock

A Dali-eque functioning clock.

$14.99Details


The Picture of Dorian Gray

Dorian Gray, a handsome young man, receives a beautiful painting of himself from his good friend Basil Hallward. In the same moment, a new acquaintance, Lord Henry, introduces Dorian to the ideals of youthfulness and hedonism, of which Gray becomes immed

$6.95Details

Vera Bradley Knot Just a Clutch Bag in Bali Gold

A new Clutch to added to the collection. Has a beautiful knoted design on the front.

$39.00Details


Michael Kors Quartz, Mother of Pearl Dial with White Acrylic Link Band - Womens Watch MK5079

It has an eye-catching mother-of-pearl dial and bezel that are adorned with crystals that glisten like diamonds.

$140.63Details

Infrared Mini Radio Controlled Marine Cobra Helicopter Gyro

Mini remote control helicopter. USB charger.

$24.94Details


Bed Fan

The Bed Fan delivers a cool breeze between the sheets--without AC costs, and without disturbing your partner.

$79.95Details

Fred and Friends OCD Cutting Board

Cut everything to perfection.

$25.00Details


Kikkerland UL01 Electro Man 4-Plug Multi-Outlet

Meet a powerful man who is more than a boring power outlet. Perfect for home, school or office, his legs and arms have three-prong sockets with enough room even for the biggest adapter.

$21.00Details

Looxcie Wearable Bluetooth Camcorder System, Android Compatible (Black)

Record what you're seeing directly to your phone.

$199.00Details


World Of Warcraft Deluxe Latex Mask, Troll, Green, One Size

Sometimes I wish I could roam around the mall like it were Azeroth. Now I can with my World of Warcraft Troll Mask!

$36.99Details

Philips Hf3470/60 Wake-up Light, White

This alarm turns a light on slowly to help you wake up. Clinically proven to make waking up more pleasant.

$99.99Details


Halo 3, Master Chief Costume, Adult Standard

Quilted jumpsuit with EVA armor, two-piece deluxe helmet, gauntlets and boot tops.

$580.46Details

Harvil Tabletop Air Hockey Table

The Harvil Tabletop Air Hockey Table is a lightweight and affordable way to introduce the fun of air hockey to children.

$149.44Details


Sphere Pen Camera - Hidden Video Spy Pen

1.5 hours of high quality video stored on 4GB memory card.

$99.99Details

Emile Henry Flame Top Pizza Stone, Black

Create marvelous pizzas at home.

$50.00Details


Fascinations AntWorks Illuminated Blue

Study the life-cycle of ants in this space-age gel habitat 3-dimensional ant city in the making.

$28.49Details

Handcrafted Figured Mahogany Case for iPhone 4/4S

Protect your phone with classic style.

$69.95Details


LEGO Star Wars Ultimate Collector's Millennium Falcon

Han Solo's famous starship is crafted from over 5,000 Lego pieces.

$499.99Details

Star Wars Storm Trooper USB Drive 4GB

Storm Trooper USB stick.

$34.99Details


Fred & Friends Ninjabread Men Cookie Cutters

3 Ninja Cutouts to make the stealthiest cookies known to mankind.

$12.99Details

Fred and Friends PIBOSS Pizza Boss Pizza Wheel

Sick of cutting pizza with a knife? Tired of cutting yourself with a pizza cutter?

$15.00Details


Iron Man 2 Macbook Decal Mac Apple skin sticker

A wise man once asked, Is it better to be feared or respected? I say, is it too much to ask for both?

$15.99Details

Kurt S. Adler 10-Light Star Wars R2D2 Light Set

This novelty light set features 10 R2D2 lights with 30-inch lead wire and 12-inch spacing.

$30.00Details


Smart Planet CDM-1 Corn Dog Maker

Make your very own corn dogs

$24.99Details

The Hungover Cookbook

Learn to cure your hangover with these delicious recipes!

$10.00Details


Silver Robot 8GB Flash Drive

When it comes to file storage, you want something as reliable as your favorite lovable robot.

$44.99Details

Cake Pop & Donut Hole Bakery

Make your own donut holes at home!

$24.99Details


Mr. Beer Premium Gold Edition Home Brew Kit

A great starting point for a beginning and intermediate brewers, it includes two of Mr. Beer's most popular beer mixes as well as everything needed to both brew and bottle your first 2 batches of top-quality beer.

$59.99Details

IMCG Fridge Monkey - Charcoal

Bottles, Cans and drinks in general shouldn't fall out of the fridge ever again.

$7.99Details


MollaSpace Cottage Incense Pot

A cement made cottage incense house. Watch the scented smoke coming out of the chimney and indulge yourself in the creativity.

$66.00Details

MATH CLASS Wall Clock mathematics teacher classroom gift

I probably will never know what time it is again.

$22.99Details


Stimulo Cat Feeding Station and Activity Center

Make your cats work for their food.

$24.92Details

iRobot Remote Controlled Cordless Electric Gutter Cleaning Robot

Looj blasts through debris, clogs and sludge and brushes your gutters clean. Stop repeated ladder repositioning and over reaching from dangerous heights.

$129.99Details


Multi Green Laser 5mw

As seen on ghost hunters. You know it is legit now!

$11.75Details


USBCELL AA Rechargable Battery

Can't find your charger? USBCELL AA Rechargeable Batteries work just like normal rechargeable batteries--but simply pop off the lid to recharge by any powered USB Port.

$19.95Details

Small 4" Round EcoSphere

A perfectly balanced ecosystem that fits on your desk.

$101.53Details


Modern Single Handle Waterfall Bathroom Vanity Vessel Sink LED Faucet, Chrome

This amazing LED faucet changes color with the temperature of the water.

$59.99Details

Jedi Dressing Gowns - Star Wars Bath Robes

Those aren't the droids you're looking for.

$88.44Details


Flip UltraHD Video Camera

Taking HD video has never been so easy or portable! Flip HD lets you capture every moment with dazzling quality without breaking the bank.

$129.00Details

Kymera Magic Wand Remote Control

Imagine walking into the room with your children and their Muggle friends watching TV, whipping out a magic wand from under your jacket and changing the channel in a flash.

$89.99Details


About Face 3: The Essentials of Interaction Design

This completely updated volume presents the effective and practical tools you need to design great desktop applications, Web 2.0 sites, and mobile devices. This book will teach you the principles of good product behavior.

$45.00Details

Stryker the Smoking Dragon Sculptural Incense Box

A peaceful house starts with dragons and incense.

$24.95Details


Don't Make Me Think: A Common Sense Approach to Web Usability, 2nd Edition

100,000 copies sold. If you do anything web related, this book is a must read.

$40.00Details


The Design of Everyday Things

Anyone who designs anything to be used by humans--from physical objects to computer programs to conceptual tools--must read this book, and it is an equally tremendous read for anyone who has to use anything created by another human.

$15.95Details

Men's Tetris Tie by Game Tie in Black

The classics of menswear and video games have finally come together to bring you this remarkable men's Tetris necktie.

$35.00Details


Portable Amp For Iphone Horn Stand White

Turn up the sound with science (and not your battery)

$24.99Details

Bamboo Wirelesskeyboard & Mouse

Environmentally friendly keyboard and mouse combo

$142.09Details


Star Wars Interactive R2D2

Dancing to Cantina Music, bringing you drinks and guarding your precious stuff. What more could you ask for from the most faithful robot in the galaxy?

$199.99Details

Bath Tissue Tyrant: Commode Dragon

Some dragons are helpful. Rest peacefully knowing this dragon is guarding the most important thing in the room.

$34.95Details


Umbra FishHotel Aquarium

Is your fish getting to old to live at home? This condo is the perfect balance of freedom and comfort for your beloved fish.

$38.50Details

Gear Wall Art with Clock

Perfect for the mechanically inclined person in your life. Perfectly balanced between art and utility.

$140.00Details


THE EX Kitchen Knife Set by Raffaele Iannello, Black

Not only functional, but also therapeutic, this five-piece knife set plus holder makes for the perfect gift and a guaranteed conversation piece.

$169.99Details


Pelican 1170 Carrying Case for Multi-Purpose - Black

Hand-held electronics protection solution. Watertight, crushproof, and dust proof. Easy open Double Throw latches. Open cell core with solid wall design - strong, light . O-ring seal. Automatic Pressure Equalization Valve. Pick N Pluck with convoluted li

$34.24Details

Stargate: SG-1 Limited Edition UK Exclusive Collector Plate Series 1 - Samantha "Sam" Carter

Sam Carter Collector Plate, Jack secretly wishes for this every christmas.

$59.95Details


PELICAN 1495-003-110 DELUXE COMPUTER CASE

Protect your laptop -- from everything. Fits up to 17 Inch Laptops

$278.52Details

Stargate: SG-1 Limited Edition UK Exclusive Collector Plate Series 1 - Dr. Daniel Jackson

On the rare occasion Daniel isn't galavanting around other worlds, and not eating in the mess, he has a decent plate to eat from.

$89.95Details


Stargate SG-1 Silver Stargate Antique Finish NECKLACE

Your personal stargate to bring with you off world.

$17.99Details


I (heart) SG-1 Mouse Pad

Everyone loves SG-1 and you will love this mouse pad.

$15.95Details


Stargate Command ID Badge Custom

Stargate Command ID Badge Custom

$9.99Details

I (heart) SG-1 Coffee Mug

Everyone loves SG-1 and you will love this coffee mug.

$15.95Details


SG1 Laptop Cover

With SG1 Guarding your laptop it will always come home safely.

$17.99Details

Earth Symbol Chevron Waist Fanny Pack Black

Printed - Fanny/Waist Pack -Great for Cosplay & Convention Travels

$12.95Details


STARGATE Movie Egyptian Egypt Party Decoration Tablecover (54" x 84")

STARGATE Movie Egyptian Egypt Party Decoration Tablecover

$7.99Details


Stargate Universe Chloe Laptop Cover

Purple laptop cover from SGU

$17.99Details

Stargate Universe Black Ceramic Logo Coffee MUG

Stargate Universe Collectible Ceramic Coffee Mug Holds over 12 ounces of your favorite drink

$14.99Details


Stargate SG-1 F-302 Fighter-Interceptor Screen Accurate Replica

The F-302 is the culmination of Stargate Command's effort to develop a strategic fighter/interceptor with limited (intra-system) hyperspace capabilities to challenge Goa'uld dominance of the air.

$49.95Details


Razer Banshee StarCraft II Gaming Headset

With its circumaural design the Razer Banshee is designed for optimal sound isolation to allow you to focus completely on your game.

$100.23Details


Razer Spectre StarCraft II Gaming Mouse

Razer Spectre StarCraft II gaming mouse is a lightweight, five button mouse that is ideal for gamers that prefer precision and control for an RTS.

$63.11Details


Razer StarCraft II Zerg Edition Messenger Bag

The Starcraft II Zerg Edition Messenger Bag is designed for gamers who want to keep their gear protected, stay comfortable, and look good doing it.

$59.77Details

Stargate SG-1 Patch Logo Embroidered Baseball Cap Black

SGC Baseball Cap. Jack wears one while fishing.

$14.95Details


Starcraft II 2 Dog Tag USB 2gb drive James Jim Raynor

Starcraft 2 Dogtag USB Stick ensures you're the coolest kid at the lan party.

$90.00Details

Stargate SG-1 Embroidered F-302 FIGHTER Logo PATCH

Embroidered Patch from Stargate SG-1 worn on the Pilots uniforms who fly the F-302

$6.99Details


The StarCraft Bible 2nd Edition: Who knew that explosions of pixels could inspire?

This is the history of StarCraft. This is the love of e-sports. This is the Bible of StarCraft.

$16.99Details




All American 921 21-1/2-Quart Pressure Cooker/Canner

This heavy-duty pressure cooker's large capacity is probably best utilized for canning (though it would also be great for a number of cooking tasks).

$199.99Details

Stargate Horus Limited Collectible Figurine by Applause

Horus Collectible figurine by Applause based on the Stargate Movie.

$99.99Details


Stargate SG-1 ATLANTIS Denim Logo Baseball Cap HAT

Sheppard would wear this while watching football with Ronan.

$19.99Details


Carhartt Men's Thermal Lined Duck Active Jacket, Brown, Large Regular

Work proven, our duck active jacket is built with 12-ounce, firm-hand, 100% ring-spun cotton duck with a 100% polyester thermal lining for on-the-job warmth.

$69.99Details


Stargate Coasters

Store your drinks on this stargate, I promise they won't get vaporized.

$29.98Details


Stargate Replica Mirror

This Stargate replica is far more than just a rigid molecular barrier that is completely impervious to Photons.

$49.99Details



Presto Pro EverSharp Electric Knife Sharpener

Razor sharp knives whenever you want - easy, automatic. Professional two-stage system sharpens in seconds. Blade guides automatically hold knife at ideal sharpening angle.

$27.00Details


Col. Samantha Carter

Sam Carter and her Trusty P90

$9.99Details

AeroGarden 2101-00B Classic Garden 7-Pod With Gourmet Herb Seed Kit - Black

Enjoy the taste and fragrance of fresh herbs, vegetables and salad greens grown right in your kitchen. The AeroGarden grows them all with no dirt, mess or pesticides.

$149.95Details



StarCraft II: Heart of the Swarm (Pre-Order)

Heart of the Swarm expansion for Starcraft 2

$59.99Details

Stargate Charm Bracelet

Chain created from five stargates with four Tuquoise blue flat shell disc beads spaced inbetween.

$3.25Details


Razer Marauder StarCraft II Gaming Keyboard

The Razer Marauder StarCraft II gaming keyboard is a full featured, tournament ready keyboard with an extremely compact design.

$98.35Details


Stargate earrings for instant transportation

This is a pair of small stargate pendants with 9 chevrons, ready to transport you to any other stargate as long as you know the address. Your geek friends will surely notice these dangling from your ears! The front and back are identical.

$14.95Details


Firefly - The Complete Series

One of the greatest shows to ever be cancelled.

$24.99Details


Something to Read on the Plane

A delightfully light-hearted variety of stories, articles, limericks, and even a quiz to see how good a passenger you are.

$0.99Details


I Am Trying to Break Your Heart - A Film About Wilco

This splendid documentary captures the band Wilco's struggles (both with their record company and within the band itself) while recording their album Yankee Hotel Foxtrot.

$24.49Details

Stargate (Ultimate Edition)

STARGATE ULTIMATE EDITION - DVD Movie

$6.99Details


Loudquietloud - A Film About the Pixies

The Pixies' 2004 reunion was the biggest thing that's happened in alternative rock since Nirvana, and filmmakers Steven Cantor and Matthew Galkin were there with their cameras, trailing the genre's progenitors across North America and Euro

$9.86Details



This is Spinal Tap (Special Edition)

You're about to get personal with one of music history's greatest and loudest heavy metal bands, Spinal Tap! Whether or not you're a die-hard fan of the group, you'll love this detailed "rockumentary" of Engand's legend

$7.49Details

Stargate: Continuum

Stargate Continuum: Movie

$9.23Details


A Very She & Him Christmas

She & Him have set out to create an intimate holiday recording of Christmas classics that helps bring new emotions out of old songs.

$9.99Details



Christmas In the Heart

2009 holiday release, the first Christmas album from the legendaryFolk/Rock singer/songwriter.

$10.99Details

Stargate Atlantis: The Complete Series Collection

Stargate Atlantis Seasons 1-5

$77.49Details




Stargate Atlantis Poster

SGA Poster from Woolsey era with Jewel Staite

$19.99Details




Stargate SG-1 - Movie Poster - 24 x 36

SG1 200th Episode Poster

$17.99Details

Vtech Kidizoom Plus Digital Camera - Blue

Little ones will have a blast taking candid pics with their Kidizoom Camera. Kidizoom includes a connector cable to plug in and watch a picture slideshow or view the 5-minute movies they've created on any TV or PC.

$89.99Details


This Is Why You're Fat: Where Dreams Become Heart Attacks

It was the birth of the nasty food web-trend. And it was delicious.

$9.99Details


Stargate Sg1 Poster #01 11x17 Master Print

Stargate SG1 Poster. This one makes me miss the show more than any other item.

$14.99Details

Joby GP1-E1EN Gorillapod Flexible Tripod (Grey)

Gorillapod lets you mount your camera just about anywhere you want so that you can include everyone in your automatic shots.

$14.26Details


Marini's Candies Chocolate Covered Bacon 1/2 lb. Gift Box

Hickory smoked bacon is cooked in the oven until golden & crisp then it's smothered in milk chocolate.

$12.95Details

Stargate SG-1 Patch Logo Embroidered Skull Cap Black

This Skull Cap is required for all off world travel.

$14.95Details


Doctor Who 11 Doctors 5" Action Figure Collector Set

This boxed set features 5 inch figures of the eleven men to portray the Doctor in the BBC series, with new costumes and new sculpts.

$99.99Details




Diablo III

Shut up and take my money Blizzard.

$59.99Details

Star Wars: The Complete Saga (Episodes I-VI) [Blu-ray]

The Ultimate Sci-Fi Series on Blu-Ray.

$86.99Details


Sci Fi Reference t-shirt

This is our remastered Sci-Fi movies reference t-shirt.

$19.95Details

Star Wars: The Old Republic

Star Wars: The Old Republic is a Massively Multiplayer Online Role-playing Game

$59.95Details


Kinect Star Wars

Feel the Force as you transform yourself into a Jedi. Fully harnesses the power of the Kinect platform to deliver a natural and intuitive Star Wars experience.

$49.96Details

LEGO Kids' 9002137 Star Wars Storm Trooper Mini-Figure Alarm Clock

A superb character mini figure style clock from the masters at Lego, featuring Alarm and a Snooze Button!

$23.99Details


Uncle Milton Lightsaber Room Light

Construct your own Jedi lightsaber and mount your creation as a room light on the wall. Eight color effects let kids personalize their lightsaber, and a wireless remote control turns the light on and off.

$24.99Details

Soft Heat Micro-Plush Top Low-Voltage Electric Heated Twin Mattress Pad, White

"Amazing" is the best word to describe this ultra-plush pad with its incredibly soft, supportive and luxurious Micro-Velour fabric top.

$65.99Details


Aurorae Classic Yoga Mats

Ultra Thick, Extra Long with Rising Moon Focal point Icon, Illuminating Colors, Eco Safe, Free from Phthalates and Latex

$34.95Details

Joss Whedon's Firefly Serenity 11x17 Original Promotional Movie Poster

Promotional Serenity Movie poster. These were given to theaters and also sci fi convention promotors to hand out to fans. Along with everything Serenity, they have become highly collectible.

$9.95Details


Flash Cooking System Sapphire Blue 000 by JETBOIL

Designed to capture and focus heat more efficiently than traditional cooking systems, the Flash brings two cups of water to a boil in only two minutes.

$80.71Details

Serenity Atlas of the Verse, Volume 1

The Atlas of The Verse is loaded with beautiful art, incredible renderings and detailed diagrams that really help bring The Verse to life.

$42.42Details


Acupressure Mat | Acupuncture Mat for Back Pain Relief | (nail bed or spike mat) (Green)

The Nayoya Mat uses the benefits of acupuncture to help the body repair itself, and heal itself from all kinds of stress such as back pain, fatigue, insomnia, high blood pressure, and muscular soreness.

$49.99Details


Radica 20Q Artificial Intelligence Game - Colors may vary since the item may come in 3 different colors

I didn't believe it would work, but I tested the online version and it got 'Satellite' correct. Impressed.

$19.99Details

Thera Cane Massager

Thera Cane self-massage device uniquely designed to apply pressure to sore muscles.

$29.95Details


Audio-Technica ATH-M50 Professional Studio Monitor Headphones

One of the most popular headphone sets in existence. Designed for DJs/Producers, they are fantastic for anyone.

$159.00Details

Fasta Pasta The Microwave Cooker

No waiting for a big pot of water to boil. Cook pasta to al dente perfection in the microwave! Saves time, energy and water.

$8.99Details


Fogless Shower Mirror with Squeegee by ToiletTree Products. Guaranteed Not to Fog, Designed Not to Fall.

Look your best by taking care of your face in your shower. This patent pending mirror is guaranteed not to fog in the shower.

$34.95Details

Blendtec Total Blender Four Side, Black

It’s an all-in-one appliance that makes smoothies, fresh juice, ice cream, milkshakes, cappuccinos, margaritas, soups, sauces, breads, dressings, salsas, and more.

$399.99Details


Snap Circuits Jr. SC-100

Curious young minds can learn the basics of electronics as they build more than 100 exciting projects with this kit. Work on projects that make sound effects, engineer different types of alarms, build touch circuits and play games.

$18.00Details


Firefly Fruity Oaty Bar Not Mandatory T-shirt XL

This cool Serenity t-shirt features the Fruity Oaty Bar ad in a high quality, vintage look print.

$22.95Details

(12x16) Serenity Movie Firefly Blueprints Reference Pack Spiral Bound Book

Blueprints in case you ever want to make your own Serenity

$42.93Details


River Tam and the Fireflies (Poster)

Join the crew of this firefly class transport ship as they aim to misbehave with hit songs such as "I Swallowed A Bug", "Nothin' Twixt My Nethers", and their new, hit single "Miranda".

$20.00Details


Stargate Atlantis: Homecoming: SGA-16 (Stargate Atlantis Legacy)

The first of a six book series set after the end of Stargate Atlantis's final season, Homecoming sees Atlantis return to the Pegasus Galaxy. But the situation in Pegasus has changed.

$7.95Details

Firefly Poster TV 11x17 Nathan Fillion Morena Baccarin Adam Baldwin Ron Glass

Firefly Reproduction Poster Print Style A 11 x 17 Inches -28cm x 44cm

$19.99Details


Roswell (Stargate SG-1, No. 9)

When a Stargate malfunction throws Colonel Cameron Mitchell, Dr. Daniel Jackson, and Colonel Sam Carter back in time, they only have minutes to live.

$7.95Details

Map of the Verse (Rolled)

Map of the Verse (Poster)

$41.50Details


Dial Home Bracelet- Gate Address to Earth for the People of the Tau'ri

The glyph pendants show each constellation of Earth's unique gate address, etched by hand into the raw naquadah (polymer clay)

$13.00Details

DiY Serenity Firefly Small Tote Bag Malcolm Reynolds

This is a brand new lightweight small purple tote bag.

$12.00Details


(24x36) Serenity Movie (Firefly Group) Poster Print

(24x36) Serenity Movie (Firefly Group) Poster Print

$9.80Details

Firefly Light Tile Pendant FF4

Firefly Light Scrabble Tile Pendant (Pendant Only)

$8.00Details


Firefly Poster TV D 11x17 Nathan Fillion Morena Baccarin Adam Baldwin Ron Glass

Firefly reproduction Approx. Size: 11 x 17 Inches - 28cm x 44cm Style D mini poster print

$24.99Details

Firefly: Still Flying: A Celebration of Joss Whedon's Acclaimed TV Series

Still Flying is a brand new celebration of all aspects of the show, featuring a wealth of rare and previously unpublished images including storyboards, production design art and candid behind the scenes photos, memories from the cast

$13.57Details


Firefly Serenity 36 Inch Full Afterburner Fiberglass Model Built, Finished, Painted, and Lighted

Full Afterburner 36 inch fiberglass Firefly model ready for display.

$599.00Details

Joss Whedon's Serenity Ornament Inara's Shuttle

Fans of Firefly will be familiar with the shuttle that Inara Serra, well-respected companion, rents from Serenity for her periods of separation from the ragtag crew.

$19.95Details


Serenity - Firefly Metal Keychain

Serenity is about freedom. Serenity is about going where you want, when you want, with nothing in The Verse to stop you.

$22.98Details


Firefly Inspired - Leaf on the Wind, Watch How I Soar Necklace

'I am a leaf on the wind. Watch how I soar.' Only a Firefly fan would appreciate the tragic beauty of Wash's last line.

$17.95Details

Serenity (Widescreen Edition)

The Firefly Movie. Picks up where Firefly left off, but doesn't alienate people who have never seen the TV show.

$9.99Details


Serenity PVC Set

You get Mal, River, and Jayne in this set of PVC figures based on Joss Whedon's blockbuster film Serenity.

$19.99Details

Done The Impossible: The Fans' Tale of Firefly & Serenity

Adam Baldwin hosts the telling of this vivid Browncoat story that features interviews with Joss Whedon, creator of Firefly and Serenity, the cast, crew, and most important, the fans themselves.

$12.95Details


Firefly Serenity in Flight Bumper Sticker

A Boat in the Air We Can All Love

$7.63Details

Firefly/Serenity Jayne Hat

This awesomely cunning hat, in the style of our favorite PR specialist from Firefly - Jayne Cobb, is made of SUPER soft acrylic in colors that perfectly match the original from the show!

$35.00Details


Serenity Define Interesting T-Shirt

Define Interesting. 1. Capable of holding one's attention. 2. Arousing a feeling of interest. 3. Oh God, oh God, we're all going to die.

$21.88Details


Bronze Firefly Wash quote bracelet

Firefly Fans and Family. I have made a bronze and leather appx 1 inch cuff with the I am a leaf on the wind leather name plate.

$35.00Details



Firefly Inspired Tshirt - Also, I Can Kill You with My Brain

A fantastic printed t-shirt inspired by the Firefly and Serenity. (Price GBP)

$9.99Details

Firefly Necklace- You can't take the sky from me

Can't take the sky from me necklace

$25.00Details


Firefly (Original Television Soundtrack)

Composer Greg Edmonson created a flavorful, guitar-based score for the adventures of the crew of Serenity. CD features exclusive bonus tracks.

$14.99Details

Serenity Firefly Crime To Be Done Mal T-shirt

Got us some crime to be done.

$17.95Details


Serenity

This action/adventure/Sci-Fi/western features an eclectic score by composer David Newman.

$17.04Details

Firefly Logo T-Shirt

We like Firefly. You like Firefly. This here's a Firefly all official-like t-shirt.

$17.99Details



Captain Mal's Pistol from Firefly - Resin cast kit - Hand Painted

Offered here is a premade cast resin kit of Jayne's Custom Lemat "Boo" from Firefly and Serenity fame.

$249.99Details


Envirosax Rosa RO.P Shoulder Bag,Multi,One Size

Envirosax shopping bags carry a message of sustainable living to a world ready to embrace a brighter ecological future.

$38.50Details

Reamde: A Novel

Reamde is a swift-paced thriller that traverses worlds virtual and real. Filled with unexpected twists and turns in which unforgettable villains and unlikely heroes.

$18.99Details


Steve Jobs

Autobiography of Steve Jobs

$17.87Details

The Feminine Mystique

This is the book that defined "the problem that has no name," that launched the Second Wave of the feminist movement.

$11.53Details


Modernist Cuisine: The Art and Science of Cooking

The ultimate cookbook. Mind-blowingly beautiful and fascinating cook book that goes into the science of cooking.

$450.07Details


Extremely Loud and Incredibly Close MTI: A Novel

Nine-year-old Oskar Schell has embarked on an urgent, secret mission that will take him through the five boroughs of New York.

$9.96Details

3M Self Adhesive Dry Erase Material. 24"" x 10-Feet Long.

Turn any wall into a dry erase board.

$12.50Details


Desktop Warfare Kits (Catapult)

Your own personal catapult.

$25.99Details


Letters to a Young Poet

Those looking for an alluring image of the solitary artist--and for an astonishing quotient of wisdom--will find both in Letters to a Young Poet.

$4.99Details

This Side of Paradise (Penguin Hardback Classics)

The story of a young man's painful sexual and intellectual awakening that echoes Fitzgerald's own career, it is also a portrait of the lost generation that followed straight on from the First World War, 'grown up to find all Gods dead, all

$16.50Details


Swann Sw351-Wma Wireless Mat Alarm

Pressure-Activated Mat For Protecting Doorways Inside Or Outside

$29.35Details

Obol, the Never-Soggy Cereal Bowl

Soggy cereal is a problem of the past.

$19.99Details


Sea To Summit Ultra-Sil Daypack

Backpack that fits on a keychain.

$26.96Details


Levitron AG Anti-Gravity Globe

Observe Earth levitate in space - only touching air!

$79.99Details

Pillow Remote Control

Never again will you have to ask, "wheres the remote" And youll never lose this remote in between the cushions. Because it IS a cushion.

$39.99Details


Fred Cool Jazz Ice Cube Tray

It is time to kick back and chill and here is a cool way to do it! Drop one of these groovy guitars into your drink, and give it a stir. Just the thing for jazzing up your favorite beverage.

$7.99Details

Sport-Brella Umbrella Chair, Blue

Tired of all the shady spots being taken? Bring your own chair and shade together!

$39.99Details


(4gb MicroSD Bundle) US Mint 1/2 Dollar - Micro SD Card Covert Coin - Secret Compartment

Spy coin helps you turn every day objects into a secret compartment.

$34.99Details

Pet Umbrella (Dog Umbrella) Keeps your Pet Dry and Comfotable in Rain

Keep your pet happy and dry in rain, sleet or snow!

$14.95Details


Glow Graffiti Toolset - Paint with Light

It's the dead of night; everyone is tucked up in bed and the owls are-a-hooting. So it's time to break out the Glow Graffiti!

$34.99Details


Men's Play Money Tie by Fun Ties in Black

This unique novelty tie features colorful play money on a durable black polyester fabric. This necktie is worth a million dollars, well a million dollars in play money.

$25.00Details

SHOT GLASS ICE MOLD (13PC. SET)

Take the chill off your next soiree when you serve guests a shot in an edible frozen glass.

$14.99Details


Ergo Lounger RS Therapeutic Face Down Lounger, Aluminum

Ergonomically designed aluminum chaise lounger with a face hole designed to relieve disk and nerve pain.

$149.00Details

Clocky Alarm Clock on Wheels, Almond

This alarm clock runs away from you to make sure you get out of bed.

$49.99Details


Zen Magnets - Gift and Retail Packed Zen Set

Zen Magnets. These super powerful and tiny magnets are a lot of fun for kids and adults.

$59.95Details

Tea Sub - Yellow Submarine Tea Infuser

We all live in a yellow submarine, a yellow submarine,a yellow subm...

$10.81Details


10 Sky Lanterns - White

Celebrate a special occasion with these amazing sky lanterns.

$28.99Details

Garden Zombie

There's A Zombie On Your Lawn! Nobody was quite sure what caused it. An alien pathogen riding the tail of Halley's Comet? Some government "rage" virus? Radiation from a downed satellite?

$89.99Details


OPI Nail Polish You Don't Know Jacques! 0.5 oz.

Beautiful nails are always in style.

$8.09Details

Suck UK Skate Mirror

The Skate Mirror is made from stainless steel and mirrored glass, as well as genuine skate trucks.

$200.00Details


OPI NAIL POLISH - MRS O'LEARY'S BBQ #W44

Beautiful nails are always in style.

$2.75Details


Jailbreak Collective Like and Dislike Stamps (Set)

Preloaded with enough ink for 5,000 assertions, the stamps give you the ability to emphatically thwack your opinion on tangible objects. Judge all the things.

$12.99Details

Das Boot

Das Boot.

$34.99Details


OPI Teenage Dream-Katy Perry Polish

Beautiful nails are always in style.

$8.99Details

Vibram Fivefingers KSO

Run around like you don't have shoes on and still enjoy the protection of having shoes!

$85.00Details


Cat Attack Scratching Post

Run for your lives! Catzilla is tearing up the city once again thanks to the Cat Attack Scratching Post!

$29.99Details

Harvest of Evil Garden Scarecrow Statue

Your personal garden scarecrow.

$135.00Details


OPI Silver Shatter Nail Polish NL E62

Beautiful nails are always in style.

$6.49Details

Norpro Nonstick Cake-Sicle Pan with 24 Sticks

I wish I had thought of this. Cakesicles. mmmm.... delicious

$19.99Details


Hops Holster 12 Can Ammo Pack

When you're ready to wage war on thirst (and possibly sobriety) the Hops Holster 12 Can Ammo Pack is the only beer holder gear you need.

$39.95Details

Dynaflex Iron Power Force 1 - Silver, Metal Powerball

The Iron Power Force One Gyro creates up to 16,000 rpm and 50 pounds of silky-smooth dynamic resistance in the palm of your hand.

$99.89Details


Nerf N-Force Marauder Long Sword - Black

A sword designed for full contact fighting.

$38.77Details

Pool Table, Tabletop

Mini pool table.

$39.95Details


The Slanket Blanket-Moss Green

A blanket that doesn't make you feel trapped.

$49.95Details

Exhaust Powered Car Jack

Jack your car up with the exhaust it's generating, simple and elegant car repair.

$224.98Details


Fish Eyes Rod and Reel with Underwater Video Camera

Underwater camera lets you watch what's happening on the line.

$59.99Details

True Fabrications Chain Bottle Rack

Use the magic chain to proudly show your wine anywhere. Simply put a bottle through the loop and let the chrome plated steel chain do the rest.

$24.95Details


Mario Bros.: Koopa Shell Plush and Backpack

You never know when you need a turtle shell.

$39.95Details

Iron Man Mark II 12 Inch Deluxe Figure

This is a must for any collector Iron Man in this full body titanium color suit just like thr prototype in the movie.

$999.99Details


MANGROOMER Do-It-Yourself Electric Back Hair Shaver

The Mangroomer Do-It-Yourself Electric Back Shaver is absolutely the best way to get rid of unwanted back hair.

$39.99Details

8 Bit Tie

A reminder of better days.

$14.99Details


Fred and Friends Hopside Down Glass

Hopside Down, is that pun not enough of a description?

$20.00Details


Tasting Beer: An Insider's Guide to the World's Greatest Drink

Everything you ever wanted to know about beer!

$16.95Details


Kotobukiya Samurai Sword Chopsticks Set: Date Masamune

The way of the warrior starts at the dinner table! Based off of real samurai warriors! Meals with honor!

$11.99Details

Sub Zero Macbook Decal Mac Apple skin sticker

Make your Mac Book go Sub-Zero in coolness.

$15.99Details


Official Barney Stinson Armani Grey Suitjamas

A salute to the perfect gentlemen. Never not wear a suit again!

$99.99Details

Electronic Guitar Shirt

You air guitar getting old? Step up your game with this rockstar guitar tshirt with built in mini amp.

$19.99Details


Classic Cassette Silicone Case Skin for Iphone 4 4th 4g

Protecting your iPhone and letting know everyone how cool you are.

$19.99Details

Bear Grylls Survival Series Ultimate Kit

The product of collaboration between Gerber and survival expert Bear Grylls, the Ultimate Kit is a 15-piece survival kit built for hostile environments.

$67.50Details


Air Swimmer Remote Control Inflatable Flying Shark

Flying Sharks. Who wouldn't want one?

$39.99Details

All My Friends Are Dead

All My Friends Are Dead presents a delightful primer for laughing at the inevitable.

$9.95Details


Ninja Coat Hook

Hang up your coat Yakuza style! This Ninja Coat Hook will transform your entry way into a dangerous Tokyo alley.

$9.11Details

Nostalgia Electrics SCM-502 Vintage Collection Old Fashioned Snow Cone Maker

This old-fashioned, carnival-style snow cone maker cart shaves ice cubes into snow. Add your choice of flavored syrup. Now you can enjoy the wonderful cool taste of Snow Cones anytime in the convenience of your own home.

$67.00Details


Bonsai Boy's Redwood Bonsai Tree - 5 Tree Forest Group metasequoia glyptostroboides

Ever want your own personal redwood forest? Now you can have this beautiful 5 tree in your home garden.

$225.00Details

Twelve South BookBook, 15-inch Hardback Leather Case for 15-inch MacBook Pro, Red

BookBook is a one-of-a-kind, hardback leather case designed exclusively for MacBook Pro.

$79.99Details


Swinging Sticks Kinetic Energy Sculpture

The Swinging Sticks Kinetic Energy Sculpture is a high end, museum quality moving display that is ideal for offices, lobbies, waiting rooms, and conference rooms.

$229.99Details

© Gift Lizard 2011