×

Find gifts by describing the person you are trying to buy for. Use things like who they are (dad), their hobbies (star wars), their personality (geek, gamer).

You searched for: dadgeekgamerfireflytravelglasscomfort

Reset Tags. (Click a tag to remove it. Add tags on the left side.)

Super Mario Time to Team Up 50-by-60-Inch Microraschel Throw Blanket

Mario and Luigi race to save the game surrounded by icons and characters from your favorite video game. Cuddle up in this warm throw for a long day of video game fun.

$29.99Details


Swiss+Tech UKCSB-1 Utili-Key 6-in-1 KeyChain MultiTool

The lightest and most compact multi-use tool ever developed.

$7.50Details

World Of Warcraft Deluxe Latex Mask, Troll, Green, One Size

Sometimes I wish I could roam around the mall like it were Azeroth. Now I can with my World of Warcraft Troll Mask!

$36.99Details


Nintendo Wall Graphics - Super Mario Bros

Level up your room with this Mario Themed wall graphics.

$74.95Details

Fred and Friends Hopside Down Glass

Hopside Down, is that pun not enough of a description?

$20.00Details


Jedi Dressing Gowns - Star Wars Bath Robes

Those aren't the droids you're looking for.

$88.44Details


The Hungover Cookbook

Learn to cure your hangover with these delicious recipes!

$10.00Details

Stryker the Smoking Dragon Sculptural Incense Box

A peaceful house starts with dragons and incense.

$24.95Details


Men's Tetris Tie by Game Tie in Black

The classics of menswear and video games have finally come together to bring you this remarkable men's Tetris necktie.

$35.00Details


Thermos Stainless King SK1005MB4 16-Ounce Leak-Proof Travel Mug, Midnight Blue

The ultra-durable, leak-proof Thermos Stainless King travel mug features an unbreakable stainless steel interior and exterior, making it a great companion for use in rough-and-tumble situations such as construction sites, delivery work, and more.

$19.43Details

Eagles Nest Outfitters DoubleNest Hammock (Orange/Grey)

The DoubleNest seats more than one person comfortably and is essential for family adventures. The DoubleNest still packs down to the size of a grapefruit, so there is no excuse to be without your ENO hammock.

$64.95Details


Satechi CR -3600 car holder mount for iPhone 4S, 4, 3G & 3GS, BlackBerry Torch, HTC EVO, DROID, Samsung EPIC on Windshield and Dashboard

Using a smartphone as a GPS? Mount it in your car properly just like a traditional GPS.

$29.99Details

Weber 386002 Q 100 Portable Propane Gas Grill

The grill ignites at the push of a button for reliable lighting, and an infinitely adjustable burner valve with a high-quality regulator makes it easy to control the heat.

$134.24Details


Sea To Summit Ultra-Sil Daypack

Backpack that fits on a keychain.

$26.96Details

Bed Fan

The Bed Fan delivers a cool breeze between the sheets--without AC costs, and without disturbing your partner.

$79.95Details


Fred Cool Jazz Ice Cube Tray

It is time to kick back and chill and here is a cool way to do it! Drop one of these groovy guitars into your drink, and give it a stir. Just the thing for jazzing up your favorite beverage.

$7.99Details

True Fabrications Chain Bottle Rack

Use the magic chain to proudly show your wine anywhere. Simply put a bottle through the loop and let the chrome plated steel chain do the rest.

$24.95Details


Exhaust Powered Car Jack

Jack your car up with the exhaust it's generating, simple and elegant car repair.

$224.98Details

Better Sleep Pillow - A Multi Position Pillow for Side Sleepers, Stomach Slee...

Now you can enjoy the benefits of the most comfortable multi-functional doctor-approved pillow.

$99.99Details


Sport-Brella Umbrella Chair, Blue

Tired of all the shady spots being taken? Bring your own chair and shade together!

$39.99Details

LEGO Star Wars Ultimate Collector's Millennium Falcon

Han Solo's famous starship is crafted from over 5,000 Lego pieces.

$499.99Details


SHOT GLASS ICE MOLD (13PC. SET)

Take the chill off your next soiree when you serve guests a shot in an edible frozen glass.

$14.99Details

Das Boot

Das Boot.

$34.99Details


Ten One Design Fling Game Controller - Ninja

Fling is a tactile game controller for iPad.

$9.50Details

Halo 3, Master Chief Costume, Adult Standard

Quilted jumpsuit with EVA armor, two-piece deluxe helmet, gauntlets and boot tops.

$580.46Details


Aperture Science Mug

Welcome to Aperture Laboratories, A Trusted Friend in Science!

$12.99Details

Lightphoria 10,000 lux SAD Light Therapy Pad (Seasonal Affective Disorder) Sunlight Simulator. 2011 model (v2.1)

Bright light has been used for over a decade to alleviate symptoms associated with Seasonal Affective Disorder (SAD), jetlag, shift work fatigue, insomnia, seasonal change and more.

$99.99Details


Wii Classic Controller Pro - Black

Created for accessibility and comfort, the Classic Controller Pro blends design elements from game systems such as the NES, Super NES, and Nintendo 64 providing seamless play control for a wide range of games.

$19.99Details

Pleo Dinosaur - A UGOBE Life Form

Pleo looks, moves, sounds and behaves like a living creature. Fully aware and cognitive, he explores his environment and interacts with people, accessories and other UGOBE dinosaurs.

$508.08Details


Hand Held Scalp Head Massager - Set of Three ( Colors May Vary )

It relieves tension as it softly massages acupressure points and stimulates sensitive nerves in your scalp.

$19.99Details

TOTO Washlet - Temperature Controlled Toilet Seat

Cold Toilets are so yesterday.

$409.86Details


Star Wars Interactive R2D2

Dancing to Cantina Music, bringing you drinks and guarding your precious stuff. What more could you ask for from the most faithful robot in the galaxy?

$199.99Details

Bamboo Wirelesskeyboard & Mouse

Environmentally friendly keyboard and mouse combo

$142.09Details


Swinging Sticks Kinetic Energy Sculpture

The Swinging Sticks Kinetic Energy Sculpture is a high end, museum quality moving display that is ideal for offices, lobbies, waiting rooms, and conference rooms.

$229.99Details

Bath Tissue Tyrant: Commode Dragon

Some dragons are helpful. Rest peacefully knowing this dragon is guarding the most important thing in the room.

$34.95Details


8 Bit Tie

A reminder of better days.

$14.99Details

Boyfriend Pillow

Want to cuddle but nobody is around? The boyfriend pillow will hold you, every night, all night.

$60.00Details


USBCELL AA Rechargable Battery

Can't find your charger? USBCELL AA Rechargeable Batteries work just like normal rechargeable batteries--but simply pop off the lid to recharge by any powered USB Port.

$19.95Details

Gear Wall Art with Clock

Perfect for the mechanically inclined person in your life. Perfectly balanced between art and utility.

$140.00Details


Zen Magnets - Gift and Retail Packed Zen Set

Zen Magnets. These super powerful and tiny magnets are a lot of fun for kids and adults.

$59.95Details

Handcrafted Figured Mahogany Case for iPhone 4/4S

Protect your phone with classic style.

$69.95Details


Kikkerland Skull Shot Glasses, Set of 4

Skull Shot Glasses, do I really need to write more than that?

$11.99Details


Wookiee Cookies: A Star Wars Cookbook

Tusken Raider Taters, Yoda Soda, C-3PO Pancakes... mmmm sounds delicious!

$18.99Details

12 Gauge Shot Glass

Fire off a few rounds with our set of 12 Gauge Shot Glasses.

$17.95Details


Peekaru Original Fleece Baby Carrier Cover Medium - Black

Share the warmth with your baby or toddler. The Peekaru Original is an environmentally friendly fleece vest that fits over you and your baby, keeping you both warm without giving up the comfort of your favorite baby carrier.

$79.95Details

Adjust-A-Cup 2-Cup Measuring Cup

Tired of having to deal with tons of different measurement cups and spoons? This elegant adjustable measuring cup solves everything.

$12.99Details


Kymera Magic Wand Remote Control

Imagine walking into the room with your children and their Muggle friends watching TV, whipping out a magic wand from under your jacket and changing the channel in a flash.

$89.99Details

Kotobukiya Samurai Sword Chopsticks Set: Date Masamune

The way of the warrior starts at the dinner table! Based off of real samurai warriors! Meals with honor!

$11.99Details


Tasting Beer: An Insider's Guide to the World's Greatest Drink

Everything you ever wanted to know about beer!

$16.95Details

Clear Blue Hawaii Molokini 2 - Person Kayak

Transparent Molokini Kayak. Discover. Explore. See. Witness fascinating lake or sea life through the sleek transparent hull. This is a great investment whether your goal is serious research or a child's voyage of discovery.

$2,243.17Details


Flip UltraHD Video Camera

Taking HD video has never been so easy or portable! Flip HD lets you capture every moment with dazzling quality without breaking the bank.

$129.00Details

About Face 3: The Essentials of Interaction Design

This completely updated volume presents the effective and practical tools you need to design great desktop applications, Web 2.0 sites, and mobile devices. This book will teach you the principles of good product behavior.

$45.00Details


Don't Make Me Think: A Common Sense Approach to Web Usability, 2nd Edition

100,000 copies sold. If you do anything web related, this book is a must read.

$40.00Details


Sub Zero Macbook Decal Mac Apple skin sticker

Make your Mac Book go Sub-Zero in coolness.

$15.99Details

The Design of Everyday Things

Anyone who designs anything to be used by humans--from physical objects to computer programs to conceptual tools--must read this book, and it is an equally tremendous read for anyone who has to use anything created by another human.

$15.95Details


Electronic Guitar Shirt

You air guitar getting old? Step up your game with this rockstar guitar tshirt with built in mini amp.

$19.99Details

Bear Grylls Survival Series Ultimate Kit

The product of collaboration between Gerber and survival expert Bear Grylls, the Ultimate Kit is a 15-piece survival kit built for hostile environments.

$67.50Details


Official Barney Stinson Armani Grey Suitjamas

A salute to the perfect gentlemen. Never not wear a suit again!

$99.99Details

Air Swimmer Remote Control Inflatable Flying Shark

Flying Sharks. Who wouldn't want one?

$39.99Details


All My Friends Are Dead

All My Friends Are Dead presents a delightful primer for laughing at the inevitable.

$9.95Details

Portable Amp For Iphone Horn Stand White

Turn up the sound with science (and not your battery)

$24.99Details


Firefly Necklace- You can't take the sky from me

Can't take the sky from me necklace

$25.00Details


Captain Mal's Pistol from Firefly - Resin cast kit - Hand Painted

Offered here is a premade cast resin kit of Jayne's Custom Lemat "Boo" from Firefly and Serenity fame.

$249.99Details

Serenity Firefly Crime To Be Done Mal T-shirt

Got us some crime to be done.

$17.95Details


Firefly Logo T-Shirt

We like Firefly. You like Firefly. This here's a Firefly all official-like t-shirt.

$17.99Details


(12x16) Serenity Movie Firefly Blueprints Reference Pack Spiral Bound Book

Blueprints in case you ever want to make your own Serenity

$42.93Details


River Tam and the Fireflies (Poster)

Join the crew of this firefly class transport ship as they aim to misbehave with hit songs such as "I Swallowed A Bug", "Nothin' Twixt My Nethers", and their new, hit single "Miranda".

$20.00Details


Firefly Fruity Oaty Bar Not Mandatory T-shirt XL

This cool Serenity t-shirt features the Fruity Oaty Bar ad in a high quality, vintage look print.

$22.95Details

Starcraft II 2 Dog Tag USB 2gb drive James Jim Raynor

Starcraft 2 Dogtag USB Stick ensures you're the coolest kid at the lan party.

$90.00Details


The StarCraft Bible 2nd Edition: Who knew that explosions of pixels could inspire?

This is the history of StarCraft. This is the love of e-sports. This is the Bible of StarCraft.

$16.99Details


Pwned Mug

PWNED.

$9.99Details

Firefly Light Tile Pendant FF4

Firefly Light Scrabble Tile Pendant (Pendant Only)

$8.00Details


Firefly: Still Flying: A Celebration of Joss Whedon's Acclaimed TV Series

Still Flying is a brand new celebration of all aspects of the show, featuring a wealth of rare and previously unpublished images including storyboards, production design art and candid behind the scenes photos, memories from the cast

$13.57Details


Joss Whedon's Serenity Ornament Inara's Shuttle

Fans of Firefly will be familiar with the shuttle that Inara Serra, well-respected companion, rents from Serenity for her periods of separation from the ragtag crew.

$19.95Details

PUR 18 Cup Dispenser with One Pitcher Filter DS-1800Z

Keep your water clear of chemicals and odors with this dispenser from PUR. Its advanced filtration system reduces more contaminants (lead, copper, zinc, etc.) than any other pour-through filter.

$27.81Details


Serenity - Firefly Metal Keychain

Serenity is about freedom. Serenity is about going where you want, when you want, with nothing in The Verse to stop you.

$22.98Details

Carhartt Men's Thermal Lined Duck Active Jacket, Brown, Large Regular

Work proven, our duck active jacket is built with 12-ounce, firm-hand, 100% ring-spun cotton duck with a 100% polyester thermal lining for on-the-job warmth.

$69.99Details


Firefly Inspired - Leaf on the Wind, Watch How I Soar Necklace

'I am a leaf on the wind. Watch how I soar.' Only a Firefly fan would appreciate the tragic beauty of Wash's last line.

$17.95Details

Pelican 1170 Carrying Case for Multi-Purpose - Black

Hand-held electronics protection solution. Watertight, crushproof, and dust proof. Easy open Double Throw latches. Open cell core with solid wall design - strong, light . O-ring seal. Automatic Pressure Equalization Valve. Pick N Pluck with convoluted li

$34.24Details


Serenity PVC Set

You get Mal, River, and Jayne in this set of PVC figures based on Joss Whedon's blockbuster film Serenity.

$19.99Details

Firefly - The Complete Series

One of the greatest shows to ever be cancelled.

$24.99Details



Serenity (Widescreen Edition)

The Firefly Movie. Picks up where Firefly left off, but doesn't alienate people who have never seen the TV show.

$9.99Details


Bronze Firefly Wash quote bracelet

Firefly Fans and Family. I have made a bronze and leather appx 1 inch cuff with the I am a leaf on the wind leather name plate.

$35.00Details

Done The Impossible: The Fans' Tale of Firefly & Serenity

Adam Baldwin hosts the telling of this vivid Browncoat story that features interviews with Joss Whedon, creator of Firefly and Serenity, the cast, crew, and most important, the fans themselves.

$12.95Details


Quantum Mechanix Serenity: Big Damn Heroes: River Tam Maquette

Serenity's psychotic killing machine River Tam

$49.98Details

Firefly/Serenity Jayne Hat

This awesomely cunning hat, in the style of our favorite PR specialist from Firefly - Jayne Cobb, is made of SUPER soft acrylic in colors that perfectly match the original from the show!

$35.00Details


Firefly Inspired Tshirt - Also, I Can Kill You with My Brain

A fantastic printed t-shirt inspired by the Firefly and Serenity. (Price GBP)

$9.99Details

Serenity Define Interesting T-Shirt

Define Interesting. 1. Capable of holding one's attention. 2. Arousing a feeling of interest. 3. Oh God, oh God, we're all going to die.

$21.88Details


Firefly (Original Television Soundtrack)

Composer Greg Edmonson created a flavorful, guitar-based score for the adventures of the crew of Serenity. CD features exclusive bonus tracks.

$14.99Details


Serenity

This action/adventure/Sci-Fi/western features an eclectic score by composer David Newman.

$17.04Details


Star Wars: The Complete Saga (Episodes I-VI) [Blu-ray]

The Ultimate Sci-Fi Series on Blu-Ray.

$86.99Details

Sci Fi Reference t-shirt

This is our remastered Sci-Fi movies reference t-shirt.

$19.95Details


Star Wars: The Old Republic

Star Wars: The Old Republic is a Massively Multiplayer Online Role-playing Game

$59.95Details

Firefly Poster TV 11x17 Nathan Fillion Morena Baccarin Adam Baldwin Ron Glass

Firefly Reproduction Poster Print Style A 11 x 17 Inches -28cm x 44cm

$19.99Details


Kinect Star Wars

Feel the Force as you transform yourself into a Jedi. Fully harnesses the power of the Kinect platform to deliver a natural and intuitive Star Wars experience.

$49.96Details

Map of the Verse (Rolled)

Map of the Verse (Poster)

$41.50Details


LEGO Kids' 9002137 Star Wars Storm Trooper Mini-Figure Alarm Clock

A superb character mini figure style clock from the masters at Lego, featuring Alarm and a Snooze Button!

$23.99Details

DiY Serenity Firefly Small Tote Bag Malcolm Reynolds

This is a brand new lightweight small purple tote bag.

$12.00Details


Soft Heat Micro-Plush Top Low-Voltage Electric Heated Twin Mattress Pad, White

"Amazing" is the best word to describe this ultra-plush pad with its incredibly soft, supportive and luxurious Micro-Velour fabric top.

$65.99Details

(24x36) Serenity Movie (Firefly Group) Poster Print

(24x36) Serenity Movie (Firefly Group) Poster Print

$9.80Details


Britax Frontier 85 Combination Booster Car Seat, Rushmore

The new Britax frontier 85 combination harness 2 booster boasts best in class forward-facing five-point harnessed weight capacity up to 85 pounds with an industry-leading 20" shoulder harness height.

$212.49Details

Firefly Poster TV D 11x17 Nathan Fillion Morena Baccarin Adam Baldwin Ron Glass

Firefly reproduction Approx. Size: 11 x 17 Inches - 28cm x 44cm Style D mini poster print

$24.99Details


Camelbak M.U.L.E. 100 oz Hydration Pack, Chili Pepper/Charcoal

The M.U.L.E. NV from Camelbak is a narrow-gauge pack for 3+ hours of all-terrain adventures in any weather.

$69.98Details

Firefly Serenity 36 Inch Full Afterburner Fiberglass Model Built, Finished, Painted, and Lighted

Full Afterburner 36 inch fiberglass Firefly model ready for display.

$599.00Details


Acupressure Mat | Acupuncture Mat for Back Pain Relief | (nail bed or spike mat) (Green)

The Nayoya Mat uses the benefits of acupuncture to help the body repair itself, and heal itself from all kinds of stress such as back pain, fatigue, insomnia, high blood pressure, and muscular soreness.

$49.99Details


Joss Whedon's Firefly Serenity 11x17 Original Promotional Movie Poster

Promotional Serenity Movie poster. These were given to theaters and also sci fi convention promotors to hand out to fans. Along with everything Serenity, they have become highly collectible.

$9.95Details

Radica 20Q Artificial Intelligence Game - Colors may vary since the item may come in 3 different colors

I didn't believe it would work, but I tested the online version and it got 'Satellite' correct. Impressed.

$19.99Details


Serenity Atlas of the Verse, Volume 1

The Atlas of The Verse is loaded with beautiful art, incredible renderings and detailed diagrams that really help bring The Verse to life.

$42.42Details


Thera Cane Massager

Thera Cane self-massage device uniquely designed to apply pressure to sore muscles.

$29.95Details

Audio-Technica ATH-M50 Professional Studio Monitor Headphones

One of the most popular headphone sets in existence. Designed for DJs/Producers, they are fantastic for anyone.

$159.00Details


Fasta Pasta The Microwave Cooker

No waiting for a big pot of water to boil. Cook pasta to al dente perfection in the microwave! Saves time, energy and water.

$8.99Details

Fogless Shower Mirror with Squeegee by ToiletTree Products. Guaranteed Not to Fog, Designed Not to Fall.

Look your best by taking care of your face in your shower. This patent pending mirror is guaranteed not to fog in the shower.

$34.95Details


iHome iHM60LT Rechargeable Mini Speaker (Blue Translucent)

The iHM60 is an amazing approach to audio that offers size defying sound. Speaker connects to a computer or other USB power source via the included USB cable to recharge the internal lithium ion battery.

$19.99Details

Bananagrams

The Anagram game that will drive you bananas. The award-winning word game that needs no pencil, paper, or board. Fast and fun.

$14.95Details


Diablo III

Shut up and take my money Blizzard.

$59.99Details

Dynaflex Iron Power Force 1 - Silver, Metal Powerball

The Iron Power Force One Gyro creates up to 16,000 rpm and 50 pounds of silky-smooth dynamic resistance in the palm of your hand.

$99.89Details


Mr. Beer Premium Gold Edition Home Brew Kit

A great starting point for a beginning and intermediate brewers, it includes two of Mr. Beer's most popular beer mixes as well as everything needed to both brew and bottle your first 2 batches of top-quality beer.

$59.99Details

IMCG Fridge Monkey - Charcoal

Bottles, Cans and drinks in general shouldn't fall out of the fridge ever again.

$7.99Details


Think Geek Star Trek Enterprise Pizza Cutter

Boldly go where no pizza has gone before with Think Geek's Star Trek Pizza Cutter.

$24.99Details

Fish Eyes Rod and Reel with Underwater Video Camera

Underwater camera lets you watch what's happening on the line.

$59.99Details


iRobot Remote Controlled Cordless Electric Gutter Cleaning Robot

Looj blasts through debris, clogs and sludge and brushes your gutters clean. Stop repeated ladder repositioning and over reaching from dangerous heights.

$129.99Details

Iron Man Mark II 12 Inch Deluxe Figure

This is a must for any collector Iron Man in this full body titanium color suit just like thr prototype in the movie.

$999.99Details


Levitron AG Anti-Gravity Globe

Observe Earth levitate in space - only touching air!

$79.99Details

Kikkerland UL01 Electro Man 4-Plug Multi-Outlet

Meet a powerful man who is more than a boring power outlet. Perfect for home, school or office, his legs and arms have three-prong sockets with enough room even for the biggest adapter.

$21.00Details


MATH CLASS Wall Clock mathematics teacher classroom gift

I probably will never know what time it is again.

$22.99Details

Tailgate Folding Wooden Picnic Table

Have a picnic anywhere with the comfort of your own personal picnic table.

$134.99Details


The Slanket Blanket-Moss Green

A blanket that doesn't make you feel trapped.

$49.95Details

Multi Green Laser 5mw

As seen on ghost hunters. You know it is legit now!

$11.75Details


Infrared Mini Radio Controlled Marine Cobra Helicopter Gyro

Mini remote control helicopter. USB charger.

$24.94Details

Mario Bros.: Koopa Shell Plush and Backpack

You never know when you need a turtle shell.

$39.95Details


Pillow Remote Control

Never again will you have to ask, "wheres the remote" And youll never lose this remote in between the cushions. Because it IS a cushion.

$39.99Details

MANGROOMER Do-It-Yourself Electric Back Hair Shaver

The Mangroomer Do-It-Yourself Electric Back Shaver is absolutely the best way to get rid of unwanted back hair.

$39.99Details


Men's Play Money Tie by Fun Ties in Black

This unique novelty tie features colorful play money on a durable black polyester fabric. This necktie is worth a million dollars, well a million dollars in play money.

$25.00Details


Sea to Summit Pocket Shower

Bring an 8 minute shower anywhere you go. Also works as a regular dry sack.

$24.21Details

Ergo Lounger RS Therapeutic Face Down Lounger, Aluminum

Ergonomically designed aluminum chaise lounger with a face hole designed to relieve disk and nerve pain.

$149.00Details


Shower Shock Caffeinated Soap

the original and world's first caffeinated soap from ThinkGeek. When you think about it, ShowerShock is the ultimate clean buzz ;)

$6.99Details

Philips Hf3470/60 Wake-up Light, White

This alarm turns a light on slowly to help you wake up. Clinically proven to make waking up more pleasant.

$99.99Details


Lush Life Party Ice Luge

Let the fun begin when your pour your favorite drink down the luge.

$22.50Details

Star Wars Storm Trooper USB Drive 4GB

Storm Trooper USB stick.

$34.99Details


10 Sky Lanterns - White

Celebrate a special occasion with these amazing sky lanterns.

$28.99Details

Garden Zombie

There's A Zombie On Your Lawn! Nobody was quite sure what caused it. An alien pathogen riding the tail of Halley's Comet? Some government "rage" virus? Radiation from a downed satellite?

$89.99Details


Iron Man 2 Macbook Decal Mac Apple skin sticker

A wise man once asked, Is it better to be feared or respected? I say, is it too much to ask for both?

$15.99Details

Kurt S. Adler 10-Light Star Wars R2D2 Light Set

This novelty light set features 10 R2D2 lights with 30-inch lead wire and 12-inch spacing.

$30.00Details


Smart Planet CDM-1 Corn Dog Maker

Make your very own corn dogs

$24.99Details

Hops Holster 12 Can Ammo Pack

When you're ready to wage war on thirst (and possibly sobriety) the Hops Holster 12 Can Ammo Pack is the only beer holder gear you need.

$39.95Details


Silver Robot 8GB Flash Drive

When it comes to file storage, you want something as reliable as your favorite lovable robot.

$44.99Details

(4gb MicroSD Bundle) US Mint 1/2 Dollar - Micro SD Card Covert Coin - Secret Compartment

Spy coin helps you turn every day objects into a secret compartment.

$34.99Details


Mindflex Duel Game

Mindflex Duel is the ultimate head-to-head brain game challenge

$74.99Details


Learning Resources Zoomy Handheld Digital Microscope

Amazing all-in-one digital microscope takes scientific inquiry to a new level - yet is easy for even a young child to use.

$59.95Details

Sphere Pen Camera - Hidden Video Spy Pen

1.5 hours of high quality video stored on 4GB memory card.

$99.99Details


Chillow ® Comfort Device

The Chillow® is a noiseless, low-cost cooling alternative that is environmentally friendly

$23.95Details

Helter Skelter Drinks Chiller

Warm drinks are so 20th century.

$33.18Details


Something to Read on the Plane

A delightfully light-hearted variety of stories, articles, limericks, and even a quiz to see how good a passenger you are.

$0.99Details

Kindle Fire, Full Color 7" Multi-touch Display, Wi-Fi

Kindle Fire isn't just for books anymore. Web, Apps, Video, Magazines, Music and More!

$199.00Details


Reamde: A Novel

Reamde is a swift-paced thriller that traverses worlds virtual and real. Filled with unexpected twists and turns in which unforgettable villains and unlikely heroes.

$18.99Details

Numi Organic Tea Flowering Gift Set in Handcrafted Mahogany Bamboo Chest: Glass Teapot & 6 Flowering Tea Blossoms

Packaged in an exotic hand-made dark mahogany bamboo case, this Flowering Gift Set is filled with six bouquets of tea leaves that blossom into a myriad of flavors from sweet and subtle to rich and bold.

$21.75Details


Presto 03430 Pizzazz Pizza Oven

The fast and easy way to bake fresh or frozen pizza. Great for frozen, homemade, take-and-bake, or deli pizza. The easy way to prepare chicken nuggets, quesadillas, fish fillets, even grilled sandwiches.

$39.96Details


Desktop Warfare Kits (Catapult)

Your own personal catapult.

$25.99Details

Kate Spade iPhone 4 Tropical

This fun striped pattern is done in bold shades of lavender, yellow-gold,blue, fuschia, pink and lime.

$25.00Details


iRobot 530 Roomba Vacuuming Robot, White

This specific Roomba model systematically cleans up to three* rooms on a single charge and gets into hard-to-reach wall edges and beneath furniture, while avoiding stairs and other drop-offs.

$249.99Details

Back to Basics TEM500 Egg-and-Muffin 2-Slice Toaster and Egg Poacher

The Egg & Muffin Toaster brings innovation to the toaster category by combining the functions of a toaster and an egg poacher into one easy-to-use appliance.

$34.00Details


Extremely Loud and Incredibly Close MTI: A Novel

Nine-year-old Oskar Schell has embarked on an urgent, secret mission that will take him through the five boroughs of New York.

$9.96Details


Sea Kelp / Moss with Chamomile Herb and Cocoa Butter Soap

The seaside scent in this natural beauty facial and body soap coupled with the invigorating hint of cocoa butter will make you feel like you are relaxing by the ocean.

$9.50Details

Magic Bullet MBR-1701 17-Piece Express Mixing Set

The magic bullet replaces a food processor, blender, and coffee grinder. Yet it occupies only the space of a coffee mug.

$38.49Details



Cuisinart GR-4N 5-in-1 Griddler

Compact in size but big in features, Cuisinart's countertop Griddler offers five-in-one functionality as a contact grill, panini press, full grill, full griddle, and half grill/half griddle.

$80.25Details

Marini's Candies Chocolate Covered Bacon 1/2 lb. Gift Box

Hickory smoked bacon is cooked in the oven until golden & crisp then it's smothered in milk chocolate.

$12.95Details


StarCraft II: Heart of the Swarm (Pre-Order)

Heart of the Swarm expansion for Starcraft 2

$59.99Details

Doctor Who 11 Doctors 5" Action Figure Collector Set

This boxed set features 5 inch figures of the eleven men to portray the Doctor in the BBC series, with new costumes and new sculpts.

$99.99Details


Razer Marauder StarCraft II Gaming Keyboard

The Razer Marauder StarCraft II gaming keyboard is a full featured, tournament ready keyboard with an extremely compact design.

$98.35Details

Razer Banshee StarCraft II Gaming Headset

With its circumaural design the Razer Banshee is designed for optimal sound isolation to allow you to focus completely on your game.

$100.23Details


Gerber 31-000751 Bear Grylls Survival Series Ultimate Knife, Serrated Edge

Intricately designed by Gerber and Bear, it's loaded with innovations that won't be found in any other fixed blade knife. Like everything in the Survival Series, it also includes Bear's Priorities of Survival pocket guide.

$42.13Details

Razer Spectre StarCraft II Gaming Mouse

Razer Spectre StarCraft II gaming mouse is a lightweight, five button mouse that is ideal for gamers that prefer precision and control for an RTS.

$63.11Details


Transformer USB Flash Memory Drive 4GB

This USB drive transforms from Leopard to USB stick in seconds.

$9.80Details

Razer StarCraft II Zerg Edition Messenger Bag

The Starcraft II Zerg Edition Messenger Bag is designed for gamers who want to keep their gear protected, stay comfortable, and look good doing it.

$59.77Details


© Gift Lizard 2011