×

Find gifts by describing the person you are trying to buy for. Use things like who they are (dad), their hobbies (star wars), their personality (geek, gamer).

You searched for: bedroomkitchenmusicdrinkingcupcookingartsygame of thronesfireflygamesgirlfriendcampingnerdwomen

Reset Tags. (Click a tag to remove it. Add tags on the left side.)

Adagio Teas 16-Ounce Ingenuitea Teapot

Great for the office or when traveling, this innovative teapot releases infused tea into a drinking cup. When tea is ready, simply place it atop the cup, causing a valve at the bottom to release and crystal-clear tea to flow down.

$17.45Details

Pantone Universe Mug Violet 7672

The PANTONE UNIVERSE mugs by Whitbread Wilkinson are made with fine bone china.

$15.95Details


Numi Organic Tea Flowering Gift Set in Handcrafted Mahogany Bamboo Chest: Glass Teapot & 6 Flowering Tea Blossoms

Packaged in an exotic hand-made dark mahogany bamboo case, this Flowering Gift Set is filled with six bouquets of tea leaves that blossom into a myriad of flavors from sweet and subtle to rich and bold.

$21.75Details

Boyfriend Pillow

Want to cuddle but nobody is around? The boyfriend pillow will hold you, every night, all night.

$60.00Details


Tea Sub - Yellow Submarine Tea Infuser

We all live in a yellow submarine, a yellow submarine,a yellow subm...

$10.81Details

The Hungover Cookbook

Learn to cure your hangover with these delicious recipes!

$10.00Details


Think Geek Star Trek Enterprise Pizza Cutter

Boldly go where no pizza has gone before with Think Geek's Star Trek Pizza Cutter.

$24.99Details

Sony ICFS79W AM/FM/Weather Band Digital Tuner Shower Radio (White)

Listen to your favorite shows while you shower.

$52.58Details


A Very She & Him Christmas

She & Him have set out to create an intimate holiday recording of Christmas classics that helps bring new emotions out of old songs.

$9.99Details

Christmas In the Heart

2009 holiday release, the first Christmas album from the legendaryFolk/Rock singer/songwriter.

$10.99Details


Silk Nightgown and Robe Set - Royal Peacocks

The robe, on the back, features a pair of majestic peacocks perched on a tree brimming with deep red autumn colors. The painting flows into the front of the robe as well as the gown.

$159.00Details

Bodum Brazil 8 cup French Press Coffee Maker, 34 oz, Black

Bodum Brazil offers a classic take on modern, functional design that will never go out of style.

$16.99Details


Cuisinart GR-4N 5-in-1 Griddler

Compact in size but big in features, Cuisinart's countertop Griddler offers five-in-one functionality as a contact grill, panini press, full grill, full griddle, and half grill/half griddle.

$80.25Details

MIU France Zinc Alloy Connoisseur Corkscrew Wine Opener

The next best thing to an in-house sommelier, this professional-quality wine opener offers the same impressive performance and stylish design as corkscrews that cost far more.

$20.99Details


Presto Pro EverSharp Electric Knife Sharpener

Razor sharp knives whenever you want - easy, automatic. Professional two-stage system sharpens in seconds. Blade guides automatically hold knife at ideal sharpening angle.

$27.00Details

AeroGarden 2101-00B Classic Garden 7-Pod With Gourmet Herb Seed Kit - Black

Enjoy the taste and fragrance of fresh herbs, vegetables and salad greens grown right in your kitchen. The AeroGarden grows them all with no dirt, mess or pesticides.

$149.95Details


All American 921 21-1/2-Quart Pressure Cooker/Canner

This heavy-duty pressure cooker's large capacity is probably best utilized for canning (though it would also be great for a number of cooking tasks).

$199.99Details

PUR 18 Cup Dispenser with One Pitcher Filter DS-1800Z

Keep your water clear of chemicals and odors with this dispenser from PUR. Its advanced filtration system reduces more contaminants (lead, copper, zinc, etc.) than any other pour-through filter.

$27.81Details


Carhartt Women's Sandstone Sierra Jacket/Sherpa-Lined,Black,Medium

Our sandstone sierra jacket is sherpa-lined for added warmth. It's made of 12-ounce, 100% cotton sandstone duck and features princess back seams for a premium fit, built-in bi-swing for ease of movement, interior rib-knit storm cuffs, two inside poc

$89.68Details


Presto 03430 Pizzazz Pizza Oven

The fast and easy way to bake fresh or frozen pizza. Great for frozen, homemade, take-and-bake, or deli pizza. The easy way to prepare chicken nuggets, quesadillas, fish fillets, even grilled sandwiches.

$39.96Details

Sterling Silver Peridot, Garnet, Amethyst, Blue Topaz and Citrine Individually Boxed Stud Earring Set

Add sparkle and variety to your wardrobe with this set of five individually boxed sterling silver stud earrings, showcasing five different colored gemstones.

$41.99Details


I Am Trying to Break Your Heart - A Film About Wilco

This splendid documentary captures the band Wilco's struggles (both with their record company and within the band itself) while recording their album Yankee Hotel Foxtrot.

$24.49Details

Sea Kelp / Moss with Chamomile Herb and Cocoa Butter Soap

The seaside scent in this natural beauty facial and body soap coupled with the invigorating hint of cocoa butter will make you feel like you are relaxing by the ocean.

$9.50Details


Loudquietloud - A Film About the Pixies

The Pixies' 2004 reunion was the biggest thing that's happened in alternative rock since Nirvana, and filmmakers Steven Cantor and Matthew Galkin were there with their cameras, trailing the genre's progenitors across North America and Euro

$9.86Details

This is Spinal Tap (Special Edition)

You're about to get personal with one of music history's greatest and loudest heavy metal bands, Spinal Tap! Whether or not you're a die-hard fan of the group, you'll love this detailed "rockumentary" of Engand's legend

$7.49Details


Sense and Sensibility

Jane Austen's most famous novel. It's about the necessity of finding a workable middle ground between passion and reason.

$9.99Details

Anna Karenina

There is no doubt that Anna Karenina, generally considered Tolstoy's best book, is definitely one ripping great read.

$24.99Details


Portable Amp For Iphone Horn Stand White

Turn up the sound with science (and not your battery)

$24.99Details

Indian Healing Clay - 2 lbs - Clay

Aztec Secret Indian Healing Clay deep cleanses skin pores, removing dirt and impurities, lifting out poisons and toxins stored in the epidermis.

$7.52Details


Madame Bovary

A story of a woman trapped in a loveless marriage in 19th century France.

$18.49Details

Sweet Valley Confidential: Ten Years Later

Jessica and Elizabeth Wakefield are back and all grown up, dealing with the complicated adult world of love, careers, betrayal, and sisterhood.

$8.80Details


The Portrait of a Lady (Penguin Classics)

A story of intense poignancy, Isabel's tale of love and betrayal still resonates with modern audiences.

$12.00Details

Mrs. Dalloway / A Room of One's Own

One of Virginia Woolf's greatest novels paired with an influential essay on the role of women in society.

$14.81Details


Orlando (Wordsworth Classics)

Virginia Woolf's Orlando 'The longest and most charming love letter in literature', playfully constructs the figure of Orlando as the fictional embodiment of Woolf's close friend and lover, Vita Sackville-West.

$4.99Details

Magic Bullet MBR-1701 17-Piece Express Mixing Set

The magic bullet replaces a food processor, blender, and coffee grinder. Yet it occupies only the space of a coffee mug.

$38.49Details


Fred and Friends PIBOSS Pizza Boss Pizza Wheel

Sick of cutting pizza with a knife? Tired of cutting yourself with a pizza cutter?

$15.00Details

Kikkerland Skull Shot Glasses, Set of 4

Skull Shot Glasses, do I really need to write more than that?

$11.99Details


Just Kids

Just Kids begins as a love story and ends as an elegy. It serves as a salute to New York City during the late sixties and seventies and to its rich and poor, its hustlers and hellions. A true fable, it is a portrait of two young artists' ascent, a p

$10.88Details

Fred and Friends Hopside Down Glass

Hopside Down, is that pun not enough of a description?

$20.00Details


Helter Skelter Drinks Chiller

Warm drinks are so 20th century.

$33.18Details


Wookiee Cookies: A Star Wars Cookbook

Tusken Raider Taters, Yoda Soda, C-3PO Pancakes... mmmm sounds delicious!

$18.99Details

Vera Bradley Convertible Kisslock in Lemon Parfait

A wallet by day and a purse by night, this convertible accessory is fun, flirty and large enough to hold a Smartphone.

$27.95Details


Michael Kors Quartz, Mother of Pearl Dial with White Acrylic Link Band - Womens Watch MK5079

It has an eye-catching mother-of-pearl dial and bezel that are adorned with crystals that glisten like diamonds.

$140.63Details

Michael Kors Perfume for Women 1 oz Eau De Parfum Spray

Creamy florals explode into exotic spices, tamed by Moroccan incense. A fragrant creation with a wealth of personality that will capture the heart of every woman.

$69.99Details


Metal Jewelry Stand Tree with an Antique Silver & Gold Finish

Iron Jewelry Tree Stand Unique tree design with leaves and branches Done in an antique silver/gold finish Works great for necklaces and bracelets and has 40 hanging positions

$23.99Details

Flowerbomb by Viktor & Rolf for Women - 3.4 Ounce EDP Spray

Launched by the design house of Viktor & Rolf.

$109.14Details


12 Gauge Shot Glass

Fire off a few rounds with our set of 12 Gauge Shot Glasses.

$17.95Details

Trish Mcevoy No. 9 Blackberry & Vanilla Musk

TRISH MCEVOY NO. 9 BLACKBERRY & VANILLA MUSK by Trish McEvoy

$48.00Details


Cake Pop & Donut Hole Bakery

Make your own donut holes at home!

$24.99Details

Flawless Sterling Silver Floating Heart, 13/16" X 13/16"

Beautiful Floating heart. Solid Sterling Silver, Excellent mirror like finish.

$79.95Details


Satya Jewelry Silver Turquoise, Hamsa, Lotus Charm Necklace

Turquoise, the stone of healing, and the Hamsa which protects against negative energies, meet the lotus as a symbol of renewal and transformation.

$98.00Details

PostSecret: Extraordinary Confessions from Ordinary Lives

A global phenomenon, exposing our individual aspirations, fantasies, and frailties -- our common humanity.

$17.68Details


Bling Jewelry Sterling Silver Turquoise Five-strand Bracelet [Jewelry]

Five strands of hand-strung turquoise nuggets are attached to a .925 sterling silver bar clasp.

$39.99Details

Lilly Pulitzer iPad & Netbook Sleeve - Nice To See You

Protect your iPad/NetBook in style.

$29.95Details


Bling Jewelry Sterling Silver Elongated Teardrop Bangle Bracelet

This bracelet is great for every day wear and elegant for dressy affairs.

$49.99Details

Stainless Steel Aqua Resin Dome Ring

Beautiful Stainless Steel Aqua Resin Dome Ring

$31.99Details


THE EX Kitchen Knife Set by Raffaele Iannello, Black

Not only functional, but also therapeutic, this five-piece knife set plus holder makes for the perfect gift and a guaranteed conversation piece.

$169.99Details

1888 Mills Luxury Cotton Made in Africa Bath Towel, White

Super soft bath towel from African cotton with sales contributing to reducing poverty in Africa.

$16.03Details


Back to Basics TEM500 Egg-and-Muffin 2-Slice Toaster and Egg Poacher

The Egg & Muffin Toaster brings innovation to the toaster category by combining the functions of a toaster and an egg poacher into one easy-to-use appliance.

$34.00Details


Adjust-A-Cup 2-Cup Measuring Cup

Tired of having to deal with tons of different measurement cups and spoons? This elegant adjustable measuring cup solves everything.

$12.99Details

Fred Cool Jazz Ice Cube Tray

It is time to kick back and chill and here is a cool way to do it! Drop one of these groovy guitars into your drink, and give it a stir. Just the thing for jazzing up your favorite beverage.

$7.99Details


True Fabrications Chain Bottle Rack

Use the magic chain to proudly show your wine anywhere. Simply put a bottle through the loop and let the chrome plated steel chain do the rest.

$24.95Details


Fred and Friends OCD Cutting Board

Cut everything to perfection.

$25.00Details

Roulette Shot Glass Bar Drinking Game Set

The party starts when the ball stops rolling!

$29.99Details


SHOT GLASS ICE MOLD (13PC. SET)

Take the chill off your next soiree when you serve guests a shot in an edible frozen glass.

$14.99Details

Lush Life Party Ice Luge

Let the fun begin when your pour your favorite drink down the luge.

$22.50Details


Emile Henry Flame Top Pizza Stone, Black

Create marvelous pizzas at home.

$50.00Details

IMCG Fridge Monkey - Charcoal

Bottles, Cans and drinks in general shouldn't fall out of the fridge ever again.

$7.99Details


Das Boot

Das Boot.

$34.99Details

Smart Planet CDM-1 Corn Dog Maker

Make your very own corn dogs

$24.99Details


Mr. Beer Premium Gold Edition Home Brew Kit

A great starting point for a beginning and intermediate brewers, it includes two of Mr. Beer's most popular beer mixes as well as everything needed to both brew and bottle your first 2 batches of top-quality beer.

$59.99Details

Soft Heat Micro-Plush Top Low-Voltage Electric Heated Twin Mattress Pad, White

"Amazing" is the best word to describe this ultra-plush pad with its incredibly soft, supportive and luxurious Micro-Velour fabric top.

$65.99Details


Flash Cooking System Sapphire Blue 000 by JETBOIL

Designed to capture and focus heat more efficiently than traditional cooking systems, the Flash brings two cups of water to a boil in only two minutes.

$80.71Details

iHome iHM60LT Rechargeable Mini Speaker (Blue Translucent)

The iHM60 is an amazing approach to audio that offers size defying sound. Speaker connects to a computer or other USB power source via the included USB cable to recharge the internal lithium ion battery.

$19.99Details


Blendtec Total Blender Four Side, Black

It’s an all-in-one appliance that makes smoothies, fresh juice, ice cream, milkshakes, cappuccinos, margaritas, soups, sauces, breads, dressings, salsas, and more.

$399.99Details

Vinturi Essential White Wine Aerator

Specially designed to aerate white wine and produce better bouquet, enhanced flavors and smoother finish

$42.89Details


Fasta Pasta The Microwave Cooker

No waiting for a big pot of water to boil. Cook pasta to al dente perfection in the microwave! Saves time, energy and water.

$8.99Details


This Is Why You're Fat: Where Dreams Become Heart Attacks

It was the birth of the nasty food web-trend. And it was delicious.

$9.99Details

Life

With The Rolling Stones, Keith Richards created the songs that roused the world, and he lived the original rock and roll life. Now, at last, the man himself tells his story of life in the crossfire hurricane.

$11.55Details


Hand Held Scalp Head Massager - Set of Three ( Colors May Vary )

It relieves tension as it softly massages acupressure points and stimulates sensitive nerves in your scalp.

$19.99Details

Thermos Stainless King SK1005MB4 16-Ounce Leak-Proof Travel Mug, Midnight Blue

The ultra-durable, leak-proof Thermos Stainless King travel mug features an unbreakable stainless steel interior and exterior, making it a great companion for use in rough-and-tumble situations such as construction sites, delivery work, and more.

$19.43Details


Gerber 31-000751 Bear Grylls Survival Series Ultimate Knife, Serrated Edge

Intricately designed by Gerber and Bear, it's loaded with innovations that won't be found in any other fixed blade knife. Like everything in the Survival Series, it also includes Bear's Priorities of Survival pocket guide.

$42.13Details

iMPROV Electronics 8.5" Boogie Board Tablet

You can utilize this writing tablet for home, office or school activity and you will never need a paper or pencil again.

$34.95Details


Moon of My Life - Swarovski Crystal AB Necklace

This necklace is inspired by words of endearment of Khal Drogo for Daenarys in George R. R. Martin's Game of Thrones, first book in the Song of Ice and Fire series.

$31.00Details

Mindflex Duel Game

Mindflex Duel is the ultimate head-to-head brain game challenge

$74.99Details


Winter is coming - Game of Thrones Unisex Cuff Bracelet

The hammered copper is accented by a rectangle of sterling silver that is stamped with the House of Stark motto "Winter is coming" from the George Martin Song of Ice and Fire series. The bracelet is then oxidized to give it a distressed look.

$45.00Details

Chillow ® Comfort Device

The Chillow® is a noiseless, low-cost cooling alternative that is environmentally friendly

$23.95Details


Game of Thrones 11x17 HD Photo Poster HBO Tv Series #05

Tyrion Lannister (Peter Dinklage) Game of Thrones poster.

$11.99Details

Something to Read on the Plane

A delightfully light-hearted variety of stories, articles, limericks, and even a quiz to see how good a passenger you are.

$0.99Details


Fierce as a Wolverine - Arya Stark Aluminum Cuff Bracelet

It is hammered on the edges and ends and stamped with one of Arya Stark's Braavosi mantras--"fierce as a wolverine"--from Game of Thrones, the first in the fantasy series "Song of Ice and Fire" by George R. R. Martin. The text is

$21.00Details

Munchkin Mozart Magic Cube

A true breakthrough in music education, the Munchkin Mozart Magic Cube will be music to your baby's ears.

$15.00Details


Swiss+Tech UKCSB-1 Utili-Key 6-in-1 KeyChain MultiTool

The lightest and most compact multi-use tool ever developed.

$7.50Details

Midnight in Paris

This is a romantic comedy set in Paris about a family that goes there because of business, and two young people who are engaged to be married in the fall have experiences there that change their lives. It's about a young man's great love for a

$17.99Details


Annie Hall

Annie Hall is one of the truest, most bittersweet romances on film.

$10.49Details

Manhattan

Manhattan is a wry, touching and finely rendered portrait of modern relationships against the backdrop of urban alienation.

$14.49Details


Joby GP1-E1EN Gorillapod Flexible Tripod (Grey)

Gorillapod lets you mount your camera just about anywhere you want so that you can include everyone in your automatic shots.

$14.26Details

Done The Impossible: The Fans' Tale of Firefly & Serenity

Adam Baldwin hosts the telling of this vivid Browncoat story that features interviews with Joss Whedon, creator of Firefly and Serenity, the cast, crew, and most important, the fans themselves.

$12.95Details


Needle, Sword of Arya Stark. Licensed from George R.R. Martin's "A Song of Ice and Fire."

Lighter, thinner, and smaller than a typical Westeros blade, the style was closer to that of Braavos across the Narrow Sea, to be used for thusting and slashing, style of combat more suited to the quick and agile, rather than those with raw strength.

$199.95Details

Iron Throne Paperweight

Keep your papers secure with this Iron Throne paperweight.

$59.99Details


Apple Macbook Laptop Game of Thrones Stark Decal

Apple Macbook Game of Thrones Stark Decal

$7.99Details

Game of Thrones Night's Watch Oath Mug

I am the watcher on the walls.

$14.99Details


Game Of Thrones Movie Poster 24x36in

Game of Thrones Poster Print

$19.97Details

Game of Thrones Khaleesi Women's T-Shirt

The Game of Thrones Khaleesi t-shirt symbolizes the power the Khaleesi has over the toughest of all warriors.

$24.99Details


Game of Thrones Dragon Egg Necklace

Among Daenerys' most prized possessions are the three petrified dragon eggs gifted to her upon marrying Khal Drogo, immortalized here with the Game of Thrones Dragon Egg Necklace.

$69.99Details


Game of Thrones House Lannister Shot Glass

One of the richest and most powerful families of Westeros is honored on this Game of Thrones House Lannister Shot Glass.

$6.99Details


Game of Thrones Art Print - Stick 'Em With The Pointy End

What's the first lesson of sword fighting? This print was inspired by everyone's favorite little mischief maker, Arya Stark. It features the Stark house colors, grey and white with an image of Needle at the top.

$15.00Details

Game of Thrones House Stark Phone & MP3 Player Skins

For a Great House that can claim a line of descent stretching back over eight thousand years, this Game of Thrones House Stark Phone & MP3 Player Skin has a lot to live up to.

$14.99Details


Game of Thrones: The Complete First Season

Game of Thrones Season 1 DVD

$44.99Details

Game of Thrones Stark Ring

Engraved with the House Stark emblem of a direwolf, the Game of Thrones Stark Ring will let your enemies know where your loyalties lie.

$29.99Details


A Game of Thrones: The Card Game

The A Game of Thrones card game can be played in a multiplayer melee format with 3-4 players, or in a one-on-one joust format with 2 players.

$22.49Details

Game of Thrones Robb Stark T-Shirt

Show your loyalty to the House Stark with the Game of Thrones Robb Stark T-Shirt.

$24.99Details


A Game Of Thrones

With this fantastic board game, players can enter the world of George R. R. Martin's best-selling A Song of Ice and Fire fantasy series and take control of one of the great houses of Westeros. Using warfare, diplomacy, and treachery, players vie for

$59.99Details

Game of Thrones Khal Drogo T-Shirt

Khal Drogo, powerful Dothraki chieftain and leader of the largest khalasar in the Dothraki Sea, has proven undefeated in Game of Thrones.

$24.99Details


Game of Thrones World Map

Map of Westeros, Essos & Valyria.

$20.00Details

Game of Thrones House Lannister Wall Plaque

Show your allegiance to the Lannisters with a house banner. Fair haired, tall and handsome, the Lannisters are the blood of Andal adventurers who carved out a mighty kingdom in the western hills and valleys.

$34.99Details


Game of Thrones

Soundtrack from Game of Thrones

$15.34Details

House Targaryen Leather iPod Case

A leather iPod Touch case featuring the symbols of House Targaryen embossed on the cover - a three headed dragon raised up in attack.

$35.00Details


Game of Thrones Patches, Song of Ice and Fire, FULL SET

These patches features my interpretation of the coats of arms of the six major houses from George R. R. Martin's "A Song of Ice and Fire" series -- Stark, Lannister, Baratheon, Targaryen, Greyjoy, and Tully.

$48.00Details

Game of Thrones Bookmark: Jon Snow

This bookmark features Jon Snow and his direwolf, Ghost. It is 2.5"x6", digitally printed on heavyweight paper and UV-coated. Watermark will not appear on the bookmarks.

$3.00Details


The George R.R. Martin Song Of Ice and Fire Hardcover Box Set featuring A Game of Thrones, A Clash of Kings, A Storm of Swords, and A Feast for Crows (Amazon Exclusive)

George R. R. Martin has created a world that is as rich and vital as any piece of historical fiction, set in an age of knights and chivalry and filled with a plethora of fascinating, multidimensional characters that you love, hate to love, or love to hat

$86.31Details


A Dance with Dragons: A Song of Ice and Fire: Book Five

In the aftermath of a colossal battle, the future of the Seven Kingdoms hangs in the balance once again--beset by newly emerging threats from every direction.

$17.48Details

Steampunk Ring Aria Lilac - Eye of the Dragon - Game of Thrones

Vintage, Recycled, and Unique Handmade and Handcrafted, Gemstone, Crystal and Pearl Jewelry

$45.00Details


Steampunk Ring - Game of Thrones Inspired Eye of the Dragon Wire Wrapped Lampwork

Steampunk is so inspiring and original. I love the twists and turns in these rings. Every ring is one of a kind with Custom Artisan Lampwork Boro Glass Beads. The artist that creates them is a great friend of mine and is so knowledgeable about glass work

$45.00Details

King Robert's Warhammer

Rhaegar fought valiantly, Rhaegar fought nobly, Rhaegar fought honorably. And Rhaegar died.

$270.00Details


A Song of Ice and Fire 2012 Wall Calendar

A Song of Ice and Fire Wall Calendar: With stunning all-original artwork from John Picacio-one of the genre's most popular artists.

$14.99Details

Ice, Sword of Eddard Stark, Damascus Edition

If you would take a man's life, you owe it to him to look into his eyes and hear his final words. And if you can not do that, then perhaps the man does not deserve to die.

$700.00Details


Game of thrones Dark T-Shirt by CafePress

Winter is Coming. Maybe it's already here. Get a T-Shirt!

$27.00Details

Young Robert Baratheon

This would be from around the time of the Battle of the Ruby Ford.

$9.99Details


Firefly - The Complete Series

One of the greatest shows to ever be cancelled.

$24.99Details


Game of Thrones Tyrion Lannister Men's T-Shirt, Medium

Tyrion Lannister T-Shirt. Surely this won't increase your debt much.

$17.99Details


Serenity (Widescreen Edition)

The Firefly Movie. Picks up where Firefly left off, but doesn't alienate people who have never seen the TV show.

$9.99Details


Longclaw, Sword of Jon Snow. Licensed from George R.R. Martin's "A Game of Thrones"

For five centuries the Valyrian steel sword Longclaw was carried by the Lords of Bear Island in the service of the Starks of Winterfell.

$249.95Details

Air Swimmer Remote Control Inflatable Flying Shark

Flying Sharks. Who wouldn't want one?

$39.99Details


Steve Jobs

Autobiography of Steve Jobs

$17.87Details

World Of Warcraft Deluxe Latex Mask, Troll, Green, One Size

Sometimes I wish I could roam around the mall like it were Azeroth. Now I can with my World of Warcraft Troll Mask!

$36.99Details


Bamboo Wirelesskeyboard & Mouse

Environmentally friendly keyboard and mouse combo

$142.09Details


Harvil Tabletop Air Hockey Table

The Harvil Tabletop Air Hockey Table is a lightweight and affordable way to introduce the fun of air hockey to children.

$149.44Details

Big Mouth Toys Toilet Mug

A toilet bowl full of brown liquid, that's just tasteless. Or funny.

$10.97Details


The Feminine Mystique

This is the book that defined "the problem that has no name," that launched the Second Wave of the feminist movement.

$11.53Details

Zen Magnets - Gift and Retail Packed Zen Set

Zen Magnets. These super powerful and tiny magnets are a lot of fun for kids and adults.

$59.95Details


Bath Tissue Tyrant: Commode Dragon

Some dragons are helpful. Rest peacefully knowing this dragon is guarding the most important thing in the room.

$34.95Details

Modernist Cuisine: The Art and Science of Cooking

The ultimate cookbook. Mind-blowingly beautiful and fascinating cook book that goes into the science of cooking.

$450.07Details


Handcrafted Figured Mahogany Case for iPhone 4/4S

Protect your phone with classic style.

$69.95Details

Chessex Dice: Pound of Dice (Pound-O-Dice) Approximately 100 Die

For only the most extreme board game player or gambler.

$18.85Details


Fred & Friends Ninjabread Men Cookie Cutters

3 Ninja Cutouts to make the stealthiest cookies known to mankind.

$12.99Details

Nintendo Wall Graphics - Super Mario Bros

Level up your room with this Mario Themed wall graphics.

$74.95Details


3M Self Adhesive Dry Erase Material. 24"" x 10-Feet Long.

Turn any wall into a dry erase board.

$12.50Details

The Brief Wondrous Life of Oscar Wao

Oscar is a sweet but disastrously overweight ghetto nerd who's from the New Jersey home he shares with his old world mother and rebellious sister's dreams of becoming the Dominican J.R.R. Tolkien and, most of all, finding love.

$10.20Details


Super Mario Time to Team Up 50-by-60-Inch Microraschel Throw Blanket

Mario and Luigi race to save the game surrounded by icons and characters from your favorite video game. Cuddle up in this warm throw for a long day of video game fun.

$29.99Details

The Golf Club Incrediball RTR RC Remote Control Golfball (Color May Vary)

A remote controlled golf ball that can be set to spin off in any direction you fancy at the flick of a switch.

$17.99Details


Can You Imagine 2320 Melting Clock

A Dali-eque functioning clock.

$14.99Details

Jedi Dressing Gowns - Star Wars Bath Robes

Those aren't the droids you're looking for.

$88.44Details


Vera Bradley Knot Just a Clutch Bag in Bali Gold

A new Clutch to added to the collection. Has a beautiful knoted design on the front.

$39.00Details

Vibram Fivefingers KSO

Run around like you don't have shoes on and still enjoy the protection of having shoes!

$85.00Details


Norpro Nonstick Cake-Sicle Pan with 24 Sticks

I wish I had thought of this. Cakesicles. mmmm.... delicious

$19.99Details

About Face 3: The Essentials of Interaction Design

This completely updated volume presents the effective and practical tools you need to design great desktop applications, Web 2.0 sites, and mobile devices. This book will teach you the principles of good product behavior.

$45.00Details


Don't Make Me Think: A Common Sense Approach to Web Usability, 2nd Edition

100,000 copies sold. If you do anything web related, this book is a must read.

$40.00Details

The Design of Everyday Things

Anyone who designs anything to be used by humans--from physical objects to computer programs to conceptual tools--must read this book, and it is an equally tremendous read for anyone who has to use anything created by another human.

$15.95Details


Elephant Ring Holder - Silver

Store your rings on this adorable elephant's trunk.

$24.99Details

Electronic Guitar Shirt

You air guitar getting old? Step up your game with this rockstar guitar tshirt with built in mini amp.

$19.99Details


Envirosax Rosa RO.P Shoulder Bag,Multi,One Size

Envirosax shopping bags carry a message of sustainable living to a world ready to embrace a brighter ecological future.

$38.50Details

Bear Grylls Survival Series Ultimate Kit

The product of collaboration between Gerber and survival expert Bear Grylls, the Ultimate Kit is a 15-piece survival kit built for hostile environments.

$67.50Details


Kate Spade iPhone 4 Tropical

This fun striped pattern is done in bold shades of lavender, yellow-gold,blue, fuschia, pink and lime.

$25.00Details

Tasting Beer: An Insider's Guide to the World's Greatest Drink

Everything you ever wanted to know about beer!

$16.95Details


Men's Tetris Tie by Game Tie in Black

The classics of menswear and video games have finally come together to bring you this remarkable men's Tetris necktie.

$35.00Details

Flip UltraHD Video Camera

Taking HD video has never been so easy or portable! Flip HD lets you capture every moment with dazzling quality without breaking the bank.

$129.00Details


All My Friends Are Dead

All My Friends Are Dead presents a delightful primer for laughing at the inevitable.

$9.95Details


Star Wars Interactive R2D2

Dancing to Cantina Music, bringing you drinks and guarding your precious stuff. What more could you ask for from the most faithful robot in the galaxy?

$199.99Details

Cuponk Boomshakalaka

Sink your ball into the cup and light it up. Get it in and you'll hear the sweet sounds of victory.

$19.77Details


Sub Zero Macbook Decal Mac Apple skin sticker

Make your Mac Book go Sub-Zero in coolness.

$15.99Details

Stryker the Smoking Dragon Sculptural Incense Box

A peaceful house starts with dragons and incense.

$24.95Details


Kindle Fire, Full Color 7" Multi-touch Display, Wi-Fi

Kindle Fire isn't just for books anymore. Web, Apps, Video, Magazines, Music and More!

$199.00Details

Swinging Sticks Kinetic Energy Sculpture

The Swinging Sticks Kinetic Energy Sculpture is a high end, museum quality moving display that is ideal for offices, lobbies, waiting rooms, and conference rooms.

$229.99Details


Reamde: A Novel

Reamde is a swift-paced thriller that traverses worlds virtual and real. Filled with unexpected twists and turns in which unforgettable villains and unlikely heroes.

$18.99Details

USBCELL AA Rechargable Battery

Can't find your charger? USBCELL AA Rechargeable Batteries work just like normal rechargeable batteries--but simply pop off the lid to recharge by any powered USB Port.

$19.95Details


Aperture Science Mug

Welcome to Aperture Laboratories, A Trusted Friend in Science!

$12.99Details

Pool Table, Tabletop

Mini pool table.

$39.95Details


Iron Man Mark II 12 Inch Deluxe Figure

This is a must for any collector Iron Man in this full body titanium color suit just like thr prototype in the movie.

$999.99Details

MATH CLASS Wall Clock mathematics teacher classroom gift

I probably will never know what time it is again.

$22.99Details


Bed Fan

The Bed Fan delivers a cool breeze between the sheets--without AC costs, and without disturbing your partner.

$79.95Details

Tailgate Folding Wooden Picnic Table

Have a picnic anywhere with the comfort of your own personal picnic table.

$134.99Details


Obol, the Never-Soggy Cereal Bowl

Soggy cereal is a problem of the past.

$19.99Details

Boon Glo Nightlight with Portable Balls, White

Boon Glo nightlight. Portable, don't heat up, turn off after 30 minutes and 95% effective at keeping monsters away all night long.

$84.99Details


Zippered Earphones

No more tangled earphone mess.

$39.99Details

Multi Green Laser 5mw

As seen on ghost hunters. You know it is legit now!

$11.75Details


Sea to Summit Pocket Shower

Bring an 8 minute shower anywhere you go. Also works as a regular dry sack.

$24.21Details

Sport-Brella Umbrella Chair, Blue

Tired of all the shady spots being taken? Bring your own chair and shade together!

$39.99Details


Better Sleep Pillow - A Multi Position Pillow for Side Sleepers, Stomach Slee...

Now you can enjoy the benefits of the most comfortable multi-functional doctor-approved pillow.

$99.99Details

Glow Graffiti Toolset - Paint with Light

It's the dead of night; everyone is tucked up in bed and the owls are-a-hooting. So it's time to break out the Glow Graffiti!

$34.99Details


Philips Hf3470/60 Wake-up Light, White

This alarm turns a light on slowly to help you wake up. Clinically proven to make waking up more pleasant.

$99.99Details

Men's Play Money Tie by Fun Ties in Black

This unique novelty tie features colorful play money on a durable black polyester fabric. This necktie is worth a million dollars, well a million dollars in play money.

$25.00Details


Kurt S. Adler 10-Light Star Wars R2D2 Light Set

This novelty light set features 10 R2D2 lights with 30-inch lead wire and 12-inch spacing.

$30.00Details

Star Wars Storm Trooper USB Drive 4GB

Storm Trooper USB stick.

$34.99Details


Fred & Friends Beat It Chopsticks Set

One end of each chopstick is a regualr chopstick shape while the other end of of the chopstick is in the shape of a drumstick.

$14.99Details

Garden Zombie

There's A Zombie On Your Lawn! Nobody was quite sure what caused it. An alien pathogen riding the tail of Halley's Comet? Some government "rage" virus? Radiation from a downed satellite?

$89.99Details


Hops Holster 12 Can Ammo Pack

When you're ready to wage war on thirst (and possibly sobriety) the Hops Holster 12 Can Ammo Pack is the only beer holder gear you need.

$39.95Details

Lumisource NESSIE Table Desk Lamp

Inspired by Nessie the Lochness Monster, this light keeps your kids company and is fun to play with.

$45.00Details


Sea To Summit Ultra-Sil Daypack

Backpack that fits on a keychain.

$26.96Details


Silver Robot 8GB Flash Drive

When it comes to file storage, you want something as reliable as your favorite lovable robot.

$44.99Details

Looxcie Wearable Bluetooth Camcorder System, Android Compatible (Black)

Record what you're seeing directly to your phone.

$199.00Details


Halo 3, Master Chief Costume, Adult Standard

Quilted jumpsuit with EVA armor, two-piece deluxe helmet, gauntlets and boot tops.

$580.46Details

MollaSpace Cottage Incense Pot

A cement made cottage incense house. Watch the scented smoke coming out of the chimney and indulge yourself in the creativity.

$66.00Details


Weber 386002 Q 100 Portable Propane Gas Grill

The grill ignites at the push of a button for reliable lighting, and an infinitely adjustable burner valve with a high-quality regulator makes it easy to control the heat.

$134.24Details

Sigma Beauty Flat Top Synthetic Kabuki - F80

This exclusive Flat Top Synthetic Kabuki was designed to deliver a flawless makeup application.

$23.38Details


Sci Fi Reference t-shirt

This is our remastered Sci-Fi movies reference t-shirt.

$19.95Details

Operation Star Wars Edition

R2D is on the blink and looking for a steady hand to help. Can you repair a cranky crankshaft or a hiccupping hologram?

$26.93Details


Ultra-Star 175G Ultimate Disc

The world standard for the sport of Ultimate, and the official disc of the USA Ultimate Championship Series.

$5.95Details

Victorinox Swiss Army Classic Pocket Knife

The Classic is the perfect pocket-size model, with seven functions, including tweezers and toothpick.

$17.50Details


Altec Lansing inMotion MIX iMT800 Portable Digital Boom Box for iPhone and iPod

Altec Lansing iMT800 "MIX" Get ready to Rock the house! Versatile iPhone/ iPod docking with three separate inputs and FM radio, LCD display

$299.95Details

Aurorae Classic Yoga Mats

Ultra Thick, Extra Long with Rising Moon Focal point Icon, Illuminating Colors, Eco Safe, Free from Phthalates and Latex

$34.95Details


Cards Against Humanity

Cards Against Humanity is a party game for horrible people. Unlike most of the party games you've played before, Cards Against Humanity is as despicable and awkward as you and your friends.

$25.00Details

Swedish Firesteel - Army Model, Black Handle

Originally developed for the Swedish Department of Defense, Swedish FireSteel is a flash of genius. Its 3,000°C spark makes fire building easy in any weather, at any altitude.

$15.05Details


Camelbak M.U.L.E. 100 oz Hydration Pack, Chili Pepper/Charcoal

The M.U.L.E. NV from Camelbak is a narrow-gauge pack for 3+ hours of all-terrain adventures in any weather.

$69.98Details

Acupressure Mat | Acupuncture Mat for Back Pain Relief | (nail bed or spike mat) (Green)

The Nayoya Mat uses the benefits of acupuncture to help the body repair itself, and heal itself from all kinds of stress such as back pain, fatigue, insomnia, high blood pressure, and muscular soreness.

$49.99Details


Radica 20Q Artificial Intelligence Game - Colors may vary since the item may come in 3 different colors

I didn't believe it would work, but I tested the online version and it got 'Satellite' correct. Impressed.

$19.99Details

Waterfi Waterproof iPod Shuffle 4th Generation 2GB - Underwater MP3 Player for Swimming & Water Sports! Waterproof Headphones Sold Separately

The Waterproof iPod Shuffle is the most versatile Waterproof MP3 Player available. You can listen to your favorite songs in high fidelity underwater in the pool, ocean, gym, snow, rain, and use it as your everyday MP3 Player!

$179.95Details


Bananagrams

The Anagram game that will drive you bananas. The award-winning word game that needs no pencil, paper, or board. Fast and fun.

$14.95Details


Firefly Serenity in Flight Bumper Sticker

A Boat in the Air We Can All Love

$7.63Details

Thera Cane Massager

Thera Cane self-massage device uniquely designed to apply pressure to sore muscles.

$29.95Details


Audio-Technica ATH-M50 Professional Studio Monitor Headphones

One of the most popular headphone sets in existence. Designed for DJs/Producers, they are fantastic for anyone.

$159.00Details


Bronze Firefly Wash quote bracelet

Firefly Fans and Family. I have made a bronze and leather appx 1 inch cuff with the I am a leaf on the wind leather name plate.

$35.00Details

Quantum Mechanix Serenity: Big Damn Heroes: River Tam Maquette

Serenity's psychotic killing machine River Tam

$49.98Details


Firefly Inspired Tshirt - Also, I Can Kill You with My Brain

A fantastic printed t-shirt inspired by the Firefly and Serenity. (Price GBP)

$9.99Details

Firefly/Serenity Jayne Hat

This awesomely cunning hat, in the style of our favorite PR specialist from Firefly - Jayne Cobb, is made of SUPER soft acrylic in colors that perfectly match the original from the show!

$35.00Details


Firefly (Original Television Soundtrack)

Composer Greg Edmonson created a flavorful, guitar-based score for the adventures of the crew of Serenity. CD features exclusive bonus tracks.

$14.99Details

Serenity Define Interesting T-Shirt

Define Interesting. 1. Capable of holding one's attention. 2. Arousing a feeling of interest. 3. Oh God, oh God, we're all going to die.

$21.88Details


Serenity

This action/adventure/Sci-Fi/western features an eclectic score by composer David Newman.

$17.04Details



Captain Mal's Pistol from Firefly - Resin cast kit - Hand Painted

Offered here is a premade cast resin kit of Jayne's Custom Lemat "Boo" from Firefly and Serenity fame.

$249.99Details

Firefly Necklace- You can't take the sky from me

Can't take the sky from me necklace

$25.00Details



(12x16) Serenity Movie Firefly Blueprints Reference Pack Spiral Bound Book

Blueprints in case you ever want to make your own Serenity

$42.93Details

Firefly Logo T-Shirt

We like Firefly. You like Firefly. This here's a Firefly all official-like t-shirt.

$17.99Details


River Tam and the Fireflies (Poster)

Join the crew of this firefly class transport ship as they aim to misbehave with hit songs such as "I Swallowed A Bug", "Nothin' Twixt My Nethers", and their new, hit single "Miranda".

$20.00Details



Map of the Verse (Rolled)

Map of the Verse (Poster)

$41.50Details

Firefly Fruity Oaty Bar Not Mandatory T-shirt XL

This cool Serenity t-shirt features the Fruity Oaty Bar ad in a high quality, vintage look print.

$22.95Details


DiY Serenity Firefly Small Tote Bag Malcolm Reynolds

This is a brand new lightweight small purple tote bag.

$12.00Details


(24x36) Serenity Movie (Firefly Group) Poster Print

(24x36) Serenity Movie (Firefly Group) Poster Print

$9.80Details

Firefly Light Tile Pendant FF4

Firefly Light Scrabble Tile Pendant (Pendant Only)

$8.00Details


Firefly Poster TV D 11x17 Nathan Fillion Morena Baccarin Adam Baldwin Ron Glass

Firefly reproduction Approx. Size: 11 x 17 Inches - 28cm x 44cm Style D mini poster print

$24.99Details

Firefly: Still Flying: A Celebration of Joss Whedon's Acclaimed TV Series

Still Flying is a brand new celebration of all aspects of the show, featuring a wealth of rare and previously unpublished images including storyboards, production design art and candid behind the scenes photos, memories from the cast

$13.57Details


Firefly Serenity 36 Inch Full Afterburner Fiberglass Model Built, Finished, Painted, and Lighted

Full Afterburner 36 inch fiberglass Firefly model ready for display.

$599.00Details

Joss Whedon's Serenity Ornament Inara's Shuttle

Fans of Firefly will be familiar with the shuttle that Inara Serra, well-respected companion, rents from Serenity for her periods of separation from the ragtag crew.

$19.95Details


Serenity - Firefly Metal Keychain

Serenity is about freedom. Serenity is about going where you want, when you want, with nothing in The Verse to stop you.

$22.98Details


Joss Whedon's Firefly Serenity 11x17 Original Promotional Movie Poster

Promotional Serenity Movie poster. These were given to theaters and also sci fi convention promotors to hand out to fans. Along with everything Serenity, they have become highly collectible.

$9.95Details

Firefly Inspired - Leaf on the Wind, Watch How I Soar Necklace

'I am a leaf on the wind. Watch how I soar.' Only a Firefly fan would appreciate the tragic beauty of Wash's last line.

$17.95Details


Serenity Atlas of the Verse, Volume 1

The Atlas of The Verse is loaded with beautiful art, incredible renderings and detailed diagrams that really help bring The Verse to life.

$42.42Details

Serenity PVC Set

You get Mal, River, and Jayne in this set of PVC figures based on Joss Whedon's blockbuster film Serenity.

$19.99Details


© Gift Lizard 2011